DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CPK14

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_181717.3 Gene:CPK14 / 818786 AraportID:AT2G41860 Length:530 Species:Arabidopsis thaliana


Alignment Length:331 Identity:110/331 - (33%)
Similarity:164/331 - (49%) Gaps:24/331 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 GTTCKGPKPKMPIKSKKVYP-PLVDSEPFKAETTPEDD--RHAALLTSTGMEINELPSNIRNTYS 478
            |..|......:..|.||.:. |    .||..|.....|  :...|...||.|       |:..|.
plant     2 GNCCGTAGSLIQDKQKKGFKLP----NPFSNEYGNHHDGLKLIVLKEPTGHE-------IKQKYK 55

  Fly   479 LGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDA--EVRVMKKL-NHPHIISLIL 540
            |||.:|.|.|.:.:.....:||..:|.|.|.|.|.|......|.  ||.:|::: .||:|::|..
plant    56 LGRELGRGEFGVTYLCTEIETGEIFACKSILKKKLKTSIDIEDVKREVEIMRQMPEHPNIVTLKE 120

  Fly   541 SVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLL 605
            :.:.:..::||:|...||:|||.|.....::|..:..:|:.:...:...|..|::|||:||||.|
plant   121 TYEDDKAVHLVMELCEGGELFDRIVARGHYTERAAASVIKTIIEVVQMCHKHGVMHRDLKPENFL 185

  Fly   606 VKLDEHGNVLELKLADFGLAC--EVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYIL 668
              .........||..||||:.  :..:....:.|:|.|:|||:|.. .||.:||:|:||:|||||
plant   186 --FANKKETASLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLRR-SYGQEIDIWSAGVILYIL 247

  Fly   669 LCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHS 733
            |||.|||.|  ..:..:..||:..:.:|....|..:.|..:|||..||..||..|.|::.:|||.
plant   248 LCGVPPFWA--ETEHGVAKAILKSVIDFKRDPWPKVSDNAKDLIKKMLHPDPRRRLTAQQVLDHP 310

  Fly   734 WTIGNK 739
            |....|
plant   311 WIQNGK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 93/261 (36%)
S_TKc 477..734 CDD:214567 93/261 (36%)
CPK14NP_181717.3 STKc_CAMK 53..311 CDD:270687 93/262 (35%)
FRQ1 351..493 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.