DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CRK1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_181647.1 Gene:CRK1 / 818713 AraportID:AT2G41140 Length:576 Species:Arabidopsis thaliana


Alignment Length:380 Identity:101/380 - (26%)
Similarity:170/380 - (44%) Gaps:57/380 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 KTMRTTGTTCKGP---KPK-----MPIKSKKVYPPLVDSEPFKAETT--------------PEDD 453
            |::..:|.|.:.|   :|.     .|..|....|.|..|.|..:.:.              |...
plant    14 KSLPVSGETNEAPTNSQPPAKSSGFPFYSPSPVPSLFKSSPSVSSSVSSTPLRIFKRPFPPPSPA 78

  Fly   454 RH--AALLTSTG-MEINEL------------------PSNIRNTYSLGRIIGDGNFAIVFKIKHR 497
            :|  |.|....| ::.||:                  .....:.|.:...:|.|:|......|.:
plant    79 KHIRAFLARRYGSVKPNEVSIPEGKECEIGLDKSFGFSKQFASHYEIDGEVGRGHFGYTCSAKGK 143

  Fly   498 Q---TGHSYALKIIDKNKCKGKEHYIDA--EVRVMKKL-NHPHIISLILSVDQNTNMYLVLEYVS 556
            :   .|...|:|:|.|:|........|.  ||::::.| .|.:::....:.:.:.|:|:|:|...
plant   144 KGSLKGQEVAVKVIPKSKMTTAIAIEDVSREVKMLRALTGHKNLVQFYDAFEDDENVYIVMELCK 208

  Fly   557 GGDLFDAITQ-VTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLA 620
            ||:|.|.|.| ..::||:.::.::..:.:.:.|.|..|:||||:||||.|....:..:  .||..
plant   209 GGELLDKILQRGGKYSEDDAKKVMVQILSVVAYCHLQGVVHRDLKPENFLFSTKDETS--PLKAI 271

  Fly   621 DFGLACEV--NDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQE 683
            ||||:..|  ::.|..:.|:..|||||:|... ||.:.|:|:.|:|.||||||..||.|  ..:.
plant   272 DFGLSDYVKPDERLNDIVGSAYYVAPEVLHRT-YGTEADMWSIGVIAYILLCGSRPFWA--RTES 333

  Fly   684 PLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSWTIGN 738
            .:|.|::.....|.:..|..:.....|.:..:|..|...|.|:...|.|.|.:|:
plant   334 GIFRAVLKAEPNFEEAPWPSLSPEAVDFVKRLLNKDYRKRLTAAQALCHPWLVGS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 81/265 (31%)
S_TKc 477..734 CDD:214567 81/265 (31%)
CRK1NP_181647.1 STKc_CAMK 122..384 CDD:270687 81/266 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.