DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and camk1b

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_021335371.1 Gene:camk1b / 794026 ZFINID:ZDB-GENE-141014-1 Length:394 Species:Danio rerio


Alignment Length:290 Identity:111/290 - (38%)
Similarity:172/290 - (59%) Gaps:10/290 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 DRHAALLTSTGMEINELPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKE 517
            ||....|...|....:..:||::.|....::|.|.|:.|...:.::|....|:|.|.|...:|||
Zfish     9 DRSKMPLGEDGPSWKKKTANIKDIYDFKEVLGTGAFSEVMLAEEKRTRKLVAVKCIAKKALEGKE 73

  Fly   518 HYIDAEVRVMKKLNHPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHL 582
            :.|:.|:.|:.|:.|.:|:||....:..:::|||::.||||:|||.|.:...::|..:..:|:.:
Zfish    74 NSIENEIAVLHKIKHANIVSLEDIFESKSHLYLVMQLVSGGELFDRIVEKGFYTEKDASKLIQQI 138

  Fly   583 GAAMTYLHSMGIVHRDIKPENLL-VKLDEHGNVLELKLADFGLACEV---NDLLYAVCGTPTYVA 643
            ..|:.|||.|||||||:|||||| ..:||...::   ::||||: ::   ..::...||||.|||
Zfish   139 LDAVKYLHDMGIVHRDLKPENLLYYSMDEESKIM---ISDFGLS-KIEGSGSVMSTACGTPGYVA 199

  Fly   644 PEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGV 708
            ||:|.:..|...:|.|:.|:|.||||||:|||.  |.....||:.|:...|||..|||.||.|..
Zfish   200 PEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFY--DENDAKLFEQILRAEYEFDSPYWDDISDSA 262

  Fly   709 RDLIANMLQADPDVRFTSEDILDHSWTIGN 738
            :|.|.::::.||:.|:|.|..|.|.|..|:
Zfish   263 KDFIVHLMEKDPNQRYTCEQALQHPWIAGD 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 103/260 (40%)
S_TKc 477..734 CDD:214567 103/260 (40%)
camk1bXP_021335371.1 PKc_like 29..291 CDD:328722 105/267 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.