DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Camkv

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_076490.1 Gene:Camkv / 79011 RGDID:621488 Length:504 Species:Rattus norvegicus


Alignment Length:282 Identity:94/282 - (33%)
Similarity:153/282 - (54%) Gaps:14/282 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 PSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPH 534
            ||.:.:.|.||:::....|..:|:.|.:.||..:..|...|...:........|:.::|.:.||:
  Rat    17 PSEVTDRYDLGQVVKTEEFCEIFRAKDKTTGKLHTCKKFQKRDGRKVRKAAKNEIGILKMVKHPN 81

  Fly   535 IISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDI 599
            |:.|:.........::.||..:|.::||.|.....:||..:..::|.:..|:.||||:.||||::
  Rat    82 ILQLVDVFVTRKEYFIFLELATGREVFDWILDQGYYSERDTSNVVRQVLEAVAYLHSLKIVHRNL 146

  Fly   600 KPENLLVKLDEHGNVL---ELKLADFGLACEVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAA 661
            |.|||:     :.|.|   ::.::||.||...|.|:...||||.|:|||::....||..:|.||.
  Rat   147 KLENLV-----YYNRLKNSKIVISDFHLAKLENGLIKEPCGTPEYLAPEVVGRQRYGRPVDCWAI 206

  Fly   662 GIILYILLCGFPPFVAP------DNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADP 720
            |:|:||||.|.|||...      :|..:.||..|::|.|||..|||.||....:||:..:::.:.
  Rat   207 GVIMYILLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEFDSPYWDDISQAAKDLVTRLMEVEQ 271

  Fly   721 DVRFTSEDILDHSWTIGNKGNE 742
            |.|.|:|:.:.|.|..||..::
  Rat   272 DQRITAEEAISHEWISGNAASD 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 89/265 (34%)
S_TKc 477..734 CDD:214567 89/265 (34%)
CamkvNP_076490.1 STKc_CaMK_like 22..286 CDD:270990 89/268 (33%)
PRK12495 <368..>445 CDD:183558
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.