DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and DCDC2C

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_006711957.1 Gene:DCDC2C / 728597 HGNCID:32696 Length:373 Species:Homo sapiens


Alignment Length:342 Identity:92/342 - (26%)
Similarity:135/342 - (39%) Gaps:72/342 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 RIPSSRTPTRKALRIKFYRNGDRFYPGITIPVSNERYRSFERLFEDLTRLLEENVKIPGAVRTIY 210
            |.||:...|..|..|..|||||.||.|....:|..|..:||.|.|.||    |.|.:|..||.::
Human     4 RGPSAPVDTTPAKTIVVYRNGDPFYVGKKFVLSRRRAATFEALLEQLT----EQVDVPFGVRRLF 64

  Fly   211 N-LCGKKITSLDELEDGQSYVCSCNNENFKKVEYNTGSQPLSNLPLSNSRSNSHRLAKCRPSSPL 274
            . ..|.::..||.|:.|..|| :...|.||:::|                  .|.:    |..|.
Human    65 TPTRGHRVLGLDALQAGGKYV-AAGRERFKELDY------------------IHIV----PRKPA 106

  Fly   275 KNGLLAGSSPFPACGGGTGNGSPLIASRLSDRVTVVHPRIVTLIRSGTKPRRIM---RLLLNKRN 336
            |...|....|...|.           ..:..:....| ||...|...|..|..:   ::::.|.:
Human   107 KIRKLKEIKPVVHCD-----------INVPSKWQTYH-RISRHINVFTNGRLFIPPAKIIIPKFS 159

  Fly   337 SPSFDHVLTAITQVVRLDTGYVRKVFTLSGIPVVRLSDFFGSDDVFF-AYGTERINTAEDFK--- 397
            ...:|.||..|.:.| ...|.|||:||::|..:....|.  .|:.|: |.|.|.......:|   
Human   160 LSDWDIVLATIGEKV-FPLGGVRKLFTMNGHLLGDSKDL--QDNHFYVAVGLETFKYFPYWKSPR 221

  Fly   398 LEAE-EQRAINVIRKTMRTTGTTCKG----------PKPKMPI------KSKKVYPPLV----DS 441
            :.:| :||..||.:.:.|......||          ||.:..:      |.|.:..|||    :.
Human   222 VPSEVQQRYANVEKNSQRKKKVDSKGKEPCKYDGIPPKTQDSVYYAKEEKKKTLAEPLVQRGAEG 286

  Fly   442 EPFKAETTPEDDRHAAL 458
            :.:|| .||..:...||
Human   287 DVYKA-PTPSKETQGAL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711 34/91 (37%)
DCX 308..396 CDD:214711 25/91 (27%)
PKc_like 477..734 CDD:304357
S_TKc 477..734 CDD:214567
DCDC2CXP_006711957.1 DCX 16..93 CDD:176357 30/81 (37%)
DCX 154..207 CDD:281590 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3757
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.