DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Dapk1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_036014050.1 Gene:Dapk1 / 69635 MGIID:1916885 Length:1464 Species:Mus musculus


Alignment Length:257 Identity:91/257 - (35%)
Similarity:150/257 - (58%) Gaps:12/257 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 GNFAIVFKIKHRQTGHSYALKIIDKNKCKG-----KEHYIDAEVRVMKKLNHPHIISLILSVDQN 545
            |.||:|.|.:.:.||..||.|.|.|.:.|.     ....|:.||.::|::.||::|:|....:..
Mouse    44 GQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIRHPNVITLHEVYENK 108

  Fly   546 TNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDE 610
            |::.|:||.|:||:|||.:.:....:|.::...::.:.:.:.||||:.|.|.|:||||::: ||.
Mouse   109 TDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILSGVYYLHSLQIAHFDLKPENIML-LDR 172

  Fly   611 HGNVLELKLADFGLACEVN--DLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFP 673
            :.....:|:.|||||.:::  :....:.|||.:|||||:.....||:.|:|:.|:|.||||.|..
Mouse   173 NVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGAS 237

  Fly   674 PFVAPDNQQEPLFDAIISGI-YEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSW 734
            ||:. |.:||.|  |.:|.: |:|.:.::.:.....:|.|..:|..||..|.|.:|.|.|.|
Mouse   238 PFLG-DTKQETL--ANVSAVNYDFEEEFFRNTSTLAKDFIRRLLVKDPKKRMTIQDSLQHPW 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 90/255 (35%)
S_TKc 477..734 CDD:214567 90/255 (35%)
Dapk1XP_036014050.1 PKc_like 35..297 CDD:419665 91/257 (35%)
Ank_2 <360..431 CDD:423045
ANK repeat 400..431 CDD:293786
Ank_4 401..453 CDD:372654
ANK repeat 434..464 CDD:293786
Ank_2 450..>661 CDD:423045
ANK repeat 466..497 CDD:293786
ANK repeat 499..530 CDD:293786
ANK repeat 532..563 CDD:293786
PLN03192 <537..790 CDD:215625
ANK repeat 565..596 CDD:293786
ANK repeat 598..629 CDD:293786
ANK repeat 631..660 CDD:293786
Death_DAPK1 1330..1415 CDD:260052
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.