DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and RGD1565323

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001103105.1 Gene:RGD1565323 / 691300 RGDID:1565323 Length:121 Species:Rattus norvegicus


Alignment Length:77 Identity:18/77 - (23%)
Similarity:30/77 - (38%) Gaps:11/77 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SPESS------SSEQDKELDDLRNLHSSSLTNSVVVGKSTGSLNGVYSITSVTSETKTLES---- 121
            :|:||      |..:.|.|:::.:.|||:....|...:....:..|.......|....|:|    
  Rat    32 TPDSSLIRLTTSMLKVKRLEEISSCHSSNPLEKVAFFQCMEEVEKVKCFLEENSSNLDLQSGDNE 96

  Fly   122 -VVTTNSASGSA 132
             .||:....|.|
  Rat    97 RTVTSPKLRGPA 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357
S_TKc 477..734 CDD:214567
RGD1565323NP_001103105.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.