DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Stk33

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_008758045.2 Gene:Stk33 / 690861 RGDID:1590972 Length:508 Species:Rattus norvegicus


Alignment Length:387 Identity:123/387 - (31%)
Similarity:203/387 - (52%) Gaps:50/387 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 SGIPVVRLS--DFFGSDDVFFAYGTER-INTAEDFKLEAEEQRAINVIRKTMRTTGTTCKGPKPK 426
            |.:.||.:|  ...||.|:|.:...:: .|.:.:..|:....|..||.||:.::..........|
  Rat    32 SPVMVVEMSQTSSIGSIDIFTSQERKKERNASRESSLKDLSTRTSNVERKSSQSQRNRSNVTGGK 96

  Fly   427 MPIKSKKVYPPLVDSEPFKAETTPEDDRHAALLTSTGMEINELPSNIRNTYSLGRIIGDGNFAIV 491
            :|                          |..:  ..|..|.|.       |:.|||:|.|:|.:|
  Rat    97 VP--------------------------HIRM--DNGASIEEF-------YTFGRILGQGSFGMV 126

  Fly   492 FKIKHRQTGHSYALKIIDKNKC-KGKEHYIDAEVRVMKKLNHPHIISLILSVDQNTNMYLVLEYV 555
            .:...::||..:|:|.::|.|. ......::.||.::|.:.|.|||.|....:....||||:|..
  Rat   127 IEATDKETGAKWAIKKVNKEKAGSSAVKLLEREVNILKTVKHQHIIHLEQVFESPQKMYLVMELC 191

  Fly   556 SGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVK---LDEHGNV-LE 616
            ..|:|.:.:.|...|||:::|::|:.|.:|:.||||..|||||:|.||::||   :|::..: |.
  Rat   192 EDGELKEVLDQRGHFSESETRLIIQSLASAIAYLHSKDIVHRDLKLENIMVKSSFIDDNNEMNLN 256

  Fly   617 LKLADFGLACEVN-----DLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFV 676
            :|::|||||.:.:     .::...||||.|:|||::....|..:.|:|:.|:|:||||||.|||:
  Rat   257 IKVSDFGLAVQKHGSRSESMMQTTCGTPIYMAPEVINAHDYSQQCDIWSIGVIMYILLCGEPPFL 321

  Fly   677 APDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSWTIGN 738
            |  |.:|.||:.|..|..:|.||.|..:.|..:..:..:::.||..|.|::::||:.|..||
  Rat   322 A--NSEEKLFELIRKGELQFQDPVWDSVSDSAKSALKQLMKVDPAHRITAKELLDNQWLTGN 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711 9/33 (27%)
PKc_like 477..734 CDD:304357 99/266 (37%)
S_TKc 477..734 CDD:214567 99/266 (37%)
Stk33XP_008758045.2 PKc_like 110..378 CDD:419665 100/276 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.