DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and STK33

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001275990.1 Gene:STK33 / 65975 HGNCID:14568 Length:514 Species:Homo sapiens


Alignment Length:369 Identity:116/369 - (31%)
Similarity:193/369 - (52%) Gaps:44/369 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 TERINTAED-FKLEAEEQRAINVIRKTMRTTGTTCKGPKPKMPIKSKKVYPPLVDSEPFKAETTP 450
            |..|.:||. ..||.::::.||                   ..|.|:|..|....:...||....
Human    45 TSSIGSAESLISLERKKEKNIN-------------------RDITSRKDLPSRTSNVERKASQQQ 90

  Fly   451 ------EDDRHAALLTSTGMEINELPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIID 509
                  .:.:...:....|..|.|:       |:.|||:|.|:|.||.:...::|...:|:|.::
Human    91 WGRGNFTEGKVPHIRIENGAAIEEI-------YTFGRILGKGSFGIVIEATDKETETKWAIKKVN 148

  Fly   510 KNKC-KGKEHYIDAEVRVMKKLNHPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSEN 573
            |.|. ......::.||.::|.:.|.|||.|....:....||||:|....|:|.:.:.:...||||
Human   149 KEKAGSSAVKLLEREVNILKSVKHEHIIHLEQVFETPKKMYLVMELCEDGELKEILDRKGHFSEN 213

  Fly   574 QSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVK---LDEHGNV-LELKLADFGLACEVND---- 630
            ::|.:|:.|.:|:.|||:..|||||:|.||::||   :|::..: |.:|:.|||||.:...    
Human   214 ETRWIIQSLASAIAYLHNNDIVHRDLKLENIMVKSSLIDDNNEINLNIKVTDFGLAVKKQSRSEA 278

  Fly   631 LLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYE 695
            :|.|.||||.|:|||::....|..:.|:|:.|:::|:||.|.|||:|  :.:|.||:.|..|...
Human   279 MLQATCGTPIYMAPEVISAHDYSQQCDIWSIGVVMYMLLRGEPPFLA--SSEEKLFELIRKGELH 341

  Fly   696 FPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSWTIGNK 739
            |.:..|:.|.|..:.::..:::.||..|.|::::||:.|..|||
Human   342 FENAVWNSISDCAKSVLKQLMKVDPAHRITAKELLDNQWLTGNK 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711 4/9 (44%)
PKc_like 477..734 CDD:304357 95/265 (36%)
S_TKc 477..734 CDD:214567 95/265 (36%)
STK33NP_001275990.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..91 8/44 (18%)
STKc_STK33 114..381 CDD:270999 96/275 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..468
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 485..514
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.