DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Dapk3

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_006241053.1 Gene:Dapk3 / 64391 RGDID:621766 Length:464 Species:Rattus norvegicus


Alignment Length:271 Identity:98/271 - (36%)
Similarity:155/271 - (57%) Gaps:12/271 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 NIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKG-----KEHYIDAEVRVMKKLN 531
            ::.:.|.:|..:|.|.||||.|.:.:.||..||.|.|.|.:...     ....|:.||.:::::.
  Rat    24 DVEDHYEMGEELGSGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSREEIEREVSILREIR 88

  Fly   532 HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVH 596
            ||:||:|....:..|::.|:||.||||:|||.:.:....:|:::...::.:...:.||||..|.|
  Rat    89 HPNIITLHDVFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAH 153

  Fly   597 RDIKPENLLVKLDEHGNVLELKLADFGLA--CEVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVW 659
            .|:||||::: ||:|.....:||.|||:|  .|.......:.|||.:|||||:.....||:.|:|
  Rat   154 FDLKPENIML-LDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGTPEFVAPEIVNYEPLGLEADMW 217

  Fly   660 AAGIILYILLCGFPPFVAPDNQQEPLFDAIISGI-YEFPDPYWSDIGDGVRDLIANMLQADPDVR 723
            :.|:|.||||.|..||:. :.:||.|.:  ||.: |:|.:.|:|...:..:|.|..:|..||..|
  Rat   218 SIGVITYILLSGASPFLG-ETKQETLTN--ISAVNYDFDEEYFSSTSELAKDFIRRLLVKDPKRR 279

  Fly   724 FTSEDILDHSW 734
            .|....|:|||
  Rat   280 MTIAQSLEHSW 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 96/264 (36%)
S_TKc 477..734 CDD:214567 96/264 (36%)
Dapk3XP_006241053.1 STKc_DAPK 23..291 CDD:271007 98/271 (36%)
S_TKc 29..291 CDD:214567 98/266 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.