DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and RP1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_016869210.1 Gene:RP1 / 6101 HGNCID:10263 Length:2163 Species:Homo sapiens


Alignment Length:417 Identity:100/417 - (23%)
Similarity:164/417 - (39%) Gaps:101/417 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ITSVTSET-KTLESVVTTNSASGSACLSNTPTADHIKKRIPSSRTPTRKALRIKFYRNGDRFYPG 172
            :::..|:| .|..|::...|:.|     ..|...|:      |.|....|.||.||::||..:.|
Human     4 VSAKMSDTPSTGFSIIHPTSSEG-----QVPPPRHL------SLTHPVVAKRISFYKSGDPQFGG 57

  Fly   173 ITIPVSNERYRSFERLFEDLTRLLEENVKIPGAVRTIYNLCGK-KITSLDELEDGQSYVCSCNNE 236
            :.:.|:...::||:.|.::|:|    .|.:|..||.|....|: .||.|:|||||:||:||    
Human    58 VRVVVNPRSFKSFDALLDNLSR----KVPLPFGVRNISTPRGRHSITRLEELEDGESYLCS---- 114

  Fly   237 NFKKVEYNTGSQPLSNLPLSNSRSNSHRLAKCRPSSPLKN-GLLAGSSPFPACGGGTGNGSPLIA 300
            :.:||      ||:.   |..:|.        ||...|.: .:.|.|.|.|......|...|   
Human   115 HGRKV------QPVD---LDKARR--------RPRPWLSSRAISAHSPPHPVAVAAPGMPRP--- 159

  Fly   301 SRLSDRVTVVHPRIVTLIRSGTKPRRIMRLLLNKRNSPSFDHVLTAITQVVRLDTGYVRKVFTLS 365
                       ||.:.:.|:| .|:....:||::|.:.||:..|..:|:|::..   |.|::...
Human   160 -----------PRSLVVFRNG-DPKTRRAVLLSRRVTQSFEAFLQHLTEVMQRP---VVKLYATD 209

  Fly   366 GIPVVRLSDFFGSDDVFFAYGTERINTA----EDFKLEAE----EQRAINVIRKTMRTTGTTCKG 422
            |..|..|.....|.....|.|.|.....    :.:.|.|.    .||..                
Human   210 GRRVPSLQAVILSSGAVVAAGREPFKPGNYDIQKYLLPARLPGISQRVY---------------- 258

  Fly   423 PKPKMPIKSKKVYPPLVDSE-----PFKAETTPEDD----------RHAALLTSTGMEINELPS- 471
            ||.....:|:|:...:..|.     ...:|.|..:|          ::.||..:....:...|| 
Human   259 PKGNAKSESRKISTHMSSSSRSQIYSVSSEKTHNNDCYLDYSFVPEKYLALEKNDSQNLPIYPSE 323

  Fly   472 -NIRNTYSLGRIIGDGNFAIVFKIKHR 497
             :|..:....:   ||...:..|::.|
Human   324 DDIEKSIIFNQ---DGTMTVEMKVRFR 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711 34/91 (37%)
DCX 308..396 CDD:214711 22/91 (24%)
PKc_like 477..734 CDD:304357 4/21 (19%)
S_TKc 477..734 CDD:214567 4/21 (19%)
RP1XP_016869210.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3757
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.