DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CAMK1G

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_065172.1 Gene:CAMK1G / 57172 HGNCID:14585 Length:476 Species:Homo sapiens


Alignment Length:269 Identity:110/269 - (40%)
Similarity:168/269 - (62%) Gaps:6/269 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 SNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHI 535
            :|||.|:....::|.|.|:.||.:|.|.||..:|||.|.|:.. .::..::.|:.|:||:.|.:|
Human    17 TNIRKTFIFMEVLGSGAFSEVFLVKQRLTGKLFALKCIKKSPA-FRDSSLENEIAVLKKIKHENI 80

  Fly   536 ISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIK 600
            ::|....:..|:.|||::.||||:|||.|.:...::|..:.::|:.:.:|:.|||..||||||:|
Human    81 VTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDASLVIQQVLSAVKYLHENGIVHRDLK 145

  Fly   601 PENLLVKLDEHGNVLELKLADFGLA-CEVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGII 664
            |||||....|..:  ::.:.||||: .|.|.::...||||.|||||:|.:..|...:|.|:.|:|
Human   146 PENLLYLTPEENS--KIMITDFGLSKMEQNGIMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVI 208

  Fly   665 LYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDI 729
            .||||||:|||.  :..:..||:.|..|.|||..|:|.||.:..:|.|.::|:.||:.|:|.|..
Human   209 TYILLCGYPPFY--EETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKA 271

  Fly   730 LDHSWTIGN 738
            |.|.|..||
Human   272 LSHPWIDGN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 103/257 (40%)
S_TKc 477..734 CDD:214567 103/257 (40%)
CAMK1GNP_065172.1 STKc_CaMKI_gamma 19..303 CDD:271068 109/267 (41%)
Autoinhibitory domain. /evidence=ECO:0000250 277..317 2/4 (50%)
Calmodulin-binding. /evidence=ECO:0000250 297..318
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 325..352
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.