DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and dapk2a

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001116536.2 Gene:dapk2a / 571352 ZFINID:ZDB-GENE-080402-8 Length:484 Species:Danio rerio


Alignment Length:278 Identity:94/278 - (33%)
Similarity:160/278 - (57%) Gaps:12/278 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 IRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGK-----EHYIDAEVRVMKKLNH 532
            :.:.:.:|..:|.|.||||.:.:.:.:|..:|.|.|.|.:....     ...|:.||.::::::|
Zfish     9 VEDFFEIGEELGSGQFAIVKQCREKSSGRDFAAKFIKKRQSNASRRGVLREEIEREVNILQQIHH 73

  Fly   533 PHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHR 597
            |:|:.|....:..|::.|:||.||||:|||.:.|....||.::...|:.:...:.||||..|.|.
Zfish    74 PNIVMLHDVFENKTDVVLILELVSGGELFDFLAQKESLSEEEATQFIKQILEGVHYLHSRNIAHF 138

  Fly   598 DIKPENLLVKLDEHGNVLELKLADFGLACEVND--LLYAVCGTPTYVAPEILLEVGYGLKIDVWA 660
            |:||||::: ||::..:..:||.|||||.::.:  ....:.|||.:|||||:.....||:.|:|:
Zfish   139 DLKPENIML-LDKNAPLPRIKLIDFGLAHKIAEGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWS 202

  Fly   661 AGIILYILLCGFPPFVAPDNQQEPLFDAIISGI-YEFPDPYWSDIGDGVRDLIANMLQADPDVRF 724
            .|:|.||||.|..||:. :.:|:.|.:  ||.: |||.|.::....:..::.|..:|:.|...|.
Zfish   203 VGVITYILLSGASPFLG-ETKQDTLGN--ISAMNYEFDDEFFGHTSELAKNFIRQLLEKDTKKRL 264

  Fly   725 TSEDILDHSWTIGNKGNE 742
            |.:|.|:|:|...|:..|
Zfish   265 TIQDALNHAWIKSNEHKE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 91/264 (34%)
S_TKc 477..734 CDD:214567 91/264 (34%)
dapk2aNP_001116536.2 PKc_like 7..275 CDD:304357 91/269 (34%)
S_TKc 13..275 CDD:214567 91/265 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.