DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CAMK1D

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_705718.1 Gene:CAMK1D / 57118 HGNCID:19341 Length:385 Species:Homo sapiens


Alignment Length:270 Identity:108/270 - (40%)
Similarity:161/270 - (59%) Gaps:8/270 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 NIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHII 536
            :|:..:.....:|.|.|:.|...:.:.||..:|:|.|.|...||||..|:.|:.|::|:.|.:|:
Human    18 DIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIV 82

  Fly   537 SLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKP 601
            :|....:...::|||::.||||:|||.|.:...::|..:..:||.:..|:.|||.|||||||:||
Human    83 ALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKP 147

  Fly   602 ENLL-VKLDEHGNVLELKLADFGLAC--EVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGI 663
            |||| ...||...::   ::||||:.  ...|::...||||.|||||:|.:..|...:|.|:.|:
Human   148 ENLLYYSQDEESKIM---ISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGV 209

  Fly   664 ILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSED 728
            |.||||||:|||.  |.....||:.|:...|||..|||.||.|..:|.|.|:::.||:.|:|.|.
Human   210 IAYILLCGYPPFY--DENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQ 272

  Fly   729 ILDHSWTIGN 738
            ...|.|..|:
Human   273 AARHPWIAGD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 105/259 (41%)
S_TKc 477..734 CDD:214567 105/259 (41%)
CAMK1DNP_705718.1 STKc_CaMKI_delta 12..312 CDD:271070 108/270 (40%)
Autoinhibitory domain. /evidence=ECO:0000250 279..319 1/4 (25%)
Calmodulin-binding. /evidence=ECO:0000250 299..320
Nuclear export signal. /evidence=ECO:0000250 318..324
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.