DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and PSKH1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_006733.1 Gene:PSKH1 / 5681 HGNCID:9529 Length:424 Species:Homo sapiens


Alignment Length:354 Identity:108/354 - (30%)
Similarity:177/354 - (50%) Gaps:38/354 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 INVIRKTMRTTGTTCK------------GP-KPKMPIKSKKVYPPLVDSEPFKAETTP--EDDRH 455
            :::::|....:||...            || |...|..|:..:|  ....|....|.|  |..|.
Human    18 LDLVKKVEPFSGTKSDVYKHFITEVDSVGPVKAGFPAASQYAHP--CPGPPTAGHTEPPSEPPRR 80

  Fly   456 AALLTSTGMEINELPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYI 520
            |.:.....    :....:...|.:..:||.|:|:.|.:::||.|...||:|:|:....:|:| ..
Human    81 ARVAKYRA----KFDPRVTAKYDIKALIGRGSFSRVVRVEHRATRQPYAIKMIETKYREGRE-VC 140

  Fly   521 DAEVRVMKKLNHPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAA 585
            ::|:||::::.|.:||.|:...:....:|:|:|..:||:|||.|.....|:|..:..:::.:...
Human   141 ESELRVLRRVRHANIIQLVEVFETQERVYMVMELATGGELFDRIIAKGSFTERDATRVLQMVLDG 205

  Fly   586 MTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGLA--------CEVNDLLYAVCGTPTYV 642
            :.|||::||.|||:||||||..  ..|...::.:.|||||        |    |:...||||.|:
Human   206 VRYLHALGITHRDLKPENLLYY--HPGTDSKIIITDFGLASARKKGDDC----LMKTTCGTPEYI 264

  Fly   643 APEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDG 707
            |||:|:...|...:|:||.|:|.||||.|..||  .|:.:..|:..|:.|.|.:....|..:.:.
Human   265 APEVLVRKPYTNSVDMWALGVIAYILLSGTMPF--EDDNRTRLYRQILRGKYSYSGEPWPSVSNL 327

  Fly   708 VRDLIANMLQADPDVRFTSEDILDHSWTI 736
            .:|.|..:|..||..|.|:...|.|.|.:
Human   328 AKDFIDRLLTVDPGARMTALQALRHPWVV 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 92/264 (35%)
S_TKc 477..734 CDD:214567 92/264 (35%)
PSKH1NP_006733.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..80 6/25 (24%)
STKc_PSKH1 96..355 CDD:270989 92/267 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..407
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.