DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and mylk3

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001099057.1 Gene:mylk3 / 561635 ZFINID:ZDB-GENE-030131-3497 Length:715 Species:Danio rerio


Alignment Length:322 Identity:96/322 - (29%)
Similarity:165/322 - (51%) Gaps:24/322 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 KKVYPPLV---DSEPFKAETTPEDDRHAALLTSTGMEINELPSNIRNTYSLGRIIGDGNFAIVFK 493
            :||...|:   ||.|..|   |.|.|.        :...::|.|.....:...::|.|.|..|.|
Zfish   367 RKVESTLLIIDDSPPLPA---PFDHRI--------VSAKQVPINSYYAVNPVEVLGGGRFGQVHK 420

  Fly   494 IKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHIISLILSVDQNTNMYLVLEYVSGG 558
            .....:|.:.|.|||.....|.::. :..|:.||.:|||.::|.|..:.:..||:.|::|||.||
Zfish   421 CAELSSGLTLAAKIIKVRGMKERDE-VKNEIGVMNQLNHVNLIQLYDAFESRTNLTLIMEYVEGG 484

  Fly   559 DLFDAITQVT-RFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADF 622
            :||:.|...: :.:|..:.:..|.:...:.|||...|:|.|:||||:|. ::..||  ::|:.||
Zfish   485 ELFERIIDESYQLTELDAIVFTRQICEGVQYLHQQYILHLDLKPENILC-VNSTGN--QIKIIDF 546

  Fly   623 GLACEV--NDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPL 685
            |||.:.  .:.|....|||.::|||::.........|:|:.|:|.|:||.|..||:. ||..|.:
Zfish   547 GLARKYRPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVITYMLLSGLSPFMG-DNDAETM 610

  Fly   686 FDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSWTIGNKGNECTTYK 747
             :.|:...:||....:.::.:..:|.|:::|.:....|.::...:.||| :.|..::...||
Zfish   611 -NNILHAKWEFDTEAFENVSEEAKDFISSLLVSAKCSRLSASGCMKHSW-LNNLEDKAKMYK 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 79/259 (31%)
S_TKc 477..734 CDD:214567 79/259 (31%)
mylk3NP_001099057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..114
STKc_MLCK3 399..659 CDD:271094 82/266 (31%)
S_TKc 407..659 CDD:214567 81/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.