Sequence 1: | NP_001036462.1 | Gene: | CG17528 / 3355134 | FlyBaseID: | FBgn0261387 | Length: | 748 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093460.1 | Gene: | dapk1 / 558314 | ZFINID: | ZDB-GENE-060526-177 | Length: | 1439 | Species: | Danio rerio |
Alignment Length: | 272 | Identity: | 101/272 - (37%) |
---|---|---|---|
Similarity: | 158/272 - (58%) | Gaps: | 14/272 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 472 NIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKG-----KEHYIDAEVRVMKKLN 531
Fly 532 HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVH 596
Fly 597 RDIKPENLLVKLDEHGNVLELKLADFGLACEV---NDLLYAVCGTPTYVAPEILLEVGYGLKIDV 658
Fly 659 WAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGI-YEFPDPYWSDIGDGVRDLIANMLQADPDV 722
Fly 723 RFTSEDILDHSW 734 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17528 | NP_001036462.1 | DCX | 153..244 | CDD:214711 | |
DCX | 308..396 | CDD:214711 | |||
PKc_like | 477..734 | CDD:304357 | 99/265 (37%) | ||
S_TKc | 477..734 | CDD:214567 | 99/265 (37%) | ||
dapk1 | NP_001093460.1 | STKc_DAPK1 | 7..275 | CDD:271096 | 101/272 (37%) |
S_TKc | 13..275 | CDD:214567 | 100/267 (37%) | ||
Ank_2 | <337..409 | CDD:289560 | |||
ANK | 373..497 | CDD:238125 | |||
ANK repeat | 378..409 | CDD:293786 | |||
Ank_4 | 379..432 | CDD:290365 | |||
ANK repeat | 412..442 | CDD:293786 | |||
Ank_2 | 416..508 | CDD:289560 | |||
ANK | 439..564 | CDD:238125 | |||
ANK repeat | 444..475 | CDD:293786 | |||
ANK repeat | 477..508 | CDD:293786 | |||
ANK | 505..629 | CDD:238125 | |||
ANK repeat | 510..541 | CDD:293786 | |||
Ank_4 | 513..564 | CDD:290365 | |||
ANK repeat | 543..574 | CDD:293786 | |||
Ank_2 | 548..635 | CDD:289560 | |||
ANK repeat | 576..607 | CDD:293786 | |||
ANK | 604..>671 | CDD:238125 | |||
ANK repeat | 609..638 | CDD:293786 | |||
Ank_4 | 610..662 | CDD:290365 | |||
Death_DAPK1 | 1310..1399 | CDD:260052 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |