DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and dapk1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001093460.1 Gene:dapk1 / 558314 ZFINID:ZDB-GENE-060526-177 Length:1439 Species:Danio rerio


Alignment Length:272 Identity:101/272 - (37%)
Similarity:158/272 - (58%) Gaps:14/272 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 NIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKG-----KEHYIDAEVRVMKKLN 531
            |:.:.|.:|..:|.|.||:|.|.:|:.||..||.|.|.|.:.|.     .:..|:.||.::|::.
Zfish     8 NVEDYYEIGGELGSGQFAVVKKCRHKSTGVEYAAKFIKKRRSKSSRRGVSKDDIEREVSILKEIQ 72

  Fly   532 HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVH 596
            ||::|:|....:....:.|:||.|:||:|||.:.:....||.::...::.:...::||||..|.|
Zfish    73 HPNVITLHDVFENKHEVILILELVAGGELFDFLAEKESLSEEEATEFLKQILDGVSYLHSKRISH 137

  Fly   597 RDIKPENLLVKLDEHGNVLELKLADFGLACEV---NDLLYAVCGTPTYVAPEILLEVGYGLKIDV 658
            .|:||||::: |:.:.....:||.|||||.::   || ...:.|||.:||||::.....||:.|:
Zfish   138 FDLKPENIML-LNRNVPHPRIKLIDFGLAHKIDFGND-FKNIFGTPEFVAPEVVNYEPLGLEADM 200

  Fly   659 WAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGI-YEFPDPYWSDIGDGVRDLIANMLQADPDV 722
            |:.|:|.||||.|..||:. :|:||.|  |.:|.: |||.:.|:|......:|.||.:|..||..
Zfish   201 WSIGVITYILLSGASPFLG-ENKQETL--ANVSAVDYEFDEDYFSHTSALAKDFIARLLIKDPKK 262

  Fly   723 RFTSEDILDHSW 734
            |.|..|.|.|.|
Zfish   263 RMTILDSLQHPW 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 99/265 (37%)
S_TKc 477..734 CDD:214567 99/265 (37%)
dapk1NP_001093460.1 STKc_DAPK1 7..275 CDD:271096 101/272 (37%)
S_TKc 13..275 CDD:214567 100/267 (37%)
Ank_2 <337..409 CDD:289560
ANK 373..497 CDD:238125
ANK repeat 378..409 CDD:293786
Ank_4 379..432 CDD:290365
ANK repeat 412..442 CDD:293786
Ank_2 416..508 CDD:289560
ANK 439..564 CDD:238125
ANK repeat 444..475 CDD:293786
ANK repeat 477..508 CDD:293786
ANK 505..629 CDD:238125
ANK repeat 510..541 CDD:293786
Ank_4 513..564 CDD:290365
ANK repeat 543..574 CDD:293786
Ank_2 548..635 CDD:289560
ANK repeat 576..607 CDD:293786
ANK 604..>671 CDD:238125
ANK repeat 609..638 CDD:293786
Ank_4 610..662 CDD:290365
Death_DAPK1 1310..1399 CDD:260052
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.