DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and camk1a

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_021332939.1 Gene:camk1a / 555945 ZFINID:ZDB-GENE-131120-147 Length:394 Species:Danio rerio


Alignment Length:272 Identity:108/272 - (39%)
Similarity:170/272 - (62%) Gaps:10/272 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 SNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHI 535
            ::|:..|....::|.|.|:.||..:.::|....|:|.|.|...:|||:.|:.|:.|:.::.|.:|
Zfish    15 TDIKENYDFKEVLGTGAFSEVFLAEEKKTQRLVAIKCIPKKALEGKENSIENEIAVLHRIKHENI 79

  Fly   536 ISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIK 600
            :||....:..:::|||::.||||:|||.|.:...::|..:..:||.:..|:.|||.|||||||:|
Zfish    80 VSLEDIFESQSHLYLVMQLVSGGELFDRIVEKGFYTERDASKLIRQILDAVKYLHDMGIVHRDLK 144

  Fly   601 PENLL-VKLDEHGNVLELKLADFGLACEVND---LLYAVCGTPTYVAPEILLEVGYGLKIDVWAA 661
            ||||| ..::|..|::   ::||||: ::.|   ::...||||.|||||:|.:..|...:|.|:.
Zfish   145 PENLLYYSMEEDSNIM---ISDFGLS-KIEDSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSI 205

  Fly   662 GIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTS 726
            |:|.||||||:|||.  |.....||:.|:...|||..|||.||.|..:|.|:::::.||.:|:|.
Zfish   206 GVISYILLCGYPPFY--DENDAKLFEQILKAEYEFDSPYWDDISDSAKDFISHLMEKDPSLRYTC 268

  Fly   727 EDILDHSWTIGN 738
            |..|.|.|..|:
Zfish   269 EQALLHPWISGD 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 105/260 (40%)
S_TKc 477..734 CDD:214567 105/260 (40%)
camk1aXP_021332939.1 STKc_CaMKI 17..276 CDD:270985 106/264 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.