DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and phkg1b

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_005161235.2 Gene:phkg1b / 554046 ZFINID:ZDB-GENE-050522-52 Length:450 Species:Danio rerio


Alignment Length:273 Identity:100/273 - (36%)
Similarity:154/273 - (56%) Gaps:24/273 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 YSLGRIIGDGNFAIVFKIKHRQTGHSYALKIID---KNKCKGKE-----HYIDAEVRVMKKLN-H 532
            |....|:|.|..::|.:...::||..||:||||   .:|...:|     .....|:.:::|:: .
Zfish    20 YDPKEILGRGVSSVVRRCVDKRTGQEYAVKIIDITPSDKMTPQEIQEIQQATVKEIDILRKVSGQ 84

  Fly   533 PHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHR 597
            .:||.|....:.....:||.:.:..|:|||.:|:....||.::|.:||.|...:.|||:..||||
Zfish    85 KNIIQLKDCFESKAFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIIRALLEVVEYLHAHNIVHR 149

  Fly   598 DIKPENLLVKLDEHGNVLELKLADFGLACEV--NDLLYAVCGTPTYVAPEIL------LEVGYGL 654
            |:||||:|  ||:..|:   ||.|||.:.::  ...|..|||||.|:||||:      ...|||.
Zfish   150 DLKPENIL--LDDDVNI---KLTDFGFSIQIEPGQRLNEVCGTPGYLAPEIIECSMDPKHSGYGT 209

  Fly   655 KIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQAD 719
            .:|:|:.|:|||.||.|.|||.  ..:|..:...|::|.|:|..|.|.|..|.|:|||:.:|..|
Zfish   210 AVDLWSTGVILYTLLAGSPPFW--HRKQMLMLRLILAGQYQFNSPEWDDRSDTVKDLISRLLVVD 272

  Fly   720 PDVRFTSEDILDH 732
            |:.|:|:.:.|:|
Zfish   273 PESRYTATEALNH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 100/273 (37%)
S_TKc 477..734 CDD:214567 100/273 (37%)
phkg1bXP_005161235.2 PKc_like 16..291 CDD:304357 100/273 (37%)
Pkinase 20..288 CDD:278497 100/273 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.