DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and capslb

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001017776.2 Gene:capslb / 550473 ZFINID:ZDB-GENE-050417-298 Length:209 Species:Danio rerio


Alignment Length:204 Identity:32/204 - (15%)
Similarity:70/204 - (34%) Gaps:62/204 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   560 LFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELK-----L 619
            :.:|..|:...|:...|:.::.|......:..:|...|        :..|::...|:||     |
Zfish    12 MINAKKQLAECSDPIERLRLQCLSRGCAGIKGLGRTFR--------IMDDDNNRTLDLKEFIKGL 68

  Fly   620 ADFGLACE--------------------VNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGII 664
            .|:|:..|                    .::.|..:....:....|::|:.  ..|:|....|:|
Zfish    69 NDYGVLMEKEEAINLFQQFDRDGSGQIDFDEFLITLRPPMSNARKEVVLQA--FKKLDKTGDGVI 131

  Fly   665 LYILLCG------FPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVR 723
            ....|.|      .|.::..:..::.:|...:.. ::.||                    |.|.:
Zfish   132 TVEDLKGVYDVRKHPKYLNGEWTEDQIFRKFLDS-FDSPD--------------------DKDGK 175

  Fly   724 FTSEDILDH 732
            .|.|:.:::
Zfish   176 VTKEEFMNY 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 32/204 (16%)
S_TKc 477..734 CDD:214567 32/204 (16%)
capslbNP_001017776.2 EF-hand_7 44..101 CDD:290234 10/64 (16%)
EFh 46..101 CDD:238008 9/62 (15%)
EFh 79..136 CDD:298682 7/58 (12%)
EF-hand_7 82..140 CDD:290234 9/59 (15%)
EF-hand_7 118..185 CDD:290234 14/90 (16%)
EFh 119..182 CDD:298682 14/85 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.