DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Dcdc2c

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_038968640.1 Gene:Dcdc2c / 500637 RGDID:1559651 Length:688 Species:Rattus norvegicus


Alignment Length:354 Identity:90/354 - (25%)
Similarity:139/354 - (39%) Gaps:79/354 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 RIPSSRTPTRKALRIKFYRNGDRFYPGITIPVSNERYRSFERLFEDLTRLLEENVKIPGAVRTIY 210
            |.|.:...|..|..|..|||||:||.|.....|..|..:||.|.|.||    |.|::|..||.:|
  Rat     4 RGPYALVDTTPAKTILVYRNGDQFYVGRKFVFSRRRVANFEALLEQLT----EQVEVPFGVRRLY 64

  Fly   211 N-LCGKKITSLDELEDGQSYVCSCNNENFKKVEYNTGSQPLSNLPLSNSRSNSHRLAKCRPSSPL 274
            . ..|.::..|:.|:.|..|| :...|.|||::|                  .|.:    |..|.
  Rat    65 TPTYGHRVLELESLQTGGKYV-AAGRERFKKLDY------------------IHIV----PRKPT 106

  Fly   275 KNGLLAGSSPFPACGGGTGNGSPLIASRLSDRVTVVHPRIVTLIRSGTKPRRIMRLLLNKRNSPS 339
            |...|....|...|...       :.||...:...  .|.:.:..:|......:::::.|.:...
  Rat   107 KMRKLKEIKPVVHCDIN-------VPSRWQTQSRT--SRYINVFTNGRLFIPPIKIIIPKFSLSD 162

  Fly   340 FDHVLTAITQVVRLDTGYVRKVFTLSGIPVVRLSDFFGSDDVFF--AYGTERINTAEDFK---LE 399
            ::.||..|.:.| ...|.|||:||:.|   ..|.|.....|.:|  |.|.|...:...:|   :.
  Rat   163 WNSVLAMIGEKV-FPLGGVRKLFTMDG---HLLDDSKNLQDNYFYVAAGLESFKSIPYWKSSWVP 223

  Fly   400 AE-EQRAINVIRKTMRTTGTTCKGPKPKMPIKSKKVYPPL------------VDSEP-------- 443
            :| :||.....:.|........||   |.|::|..|.|.:            :|:||        
  Rat   224 SEVQQRFGRNDKYTQTKKRVEYKG---KEPLQSDSVPPKIQDSVYYAKEKKQMDTEPLIESGAEG 285

  Fly   444 --FKAETTPEDDRHAALLTSTGMEINELP 470
              :||:|..::.:.|       :|:.|.|
  Rat   286 DVYKAQTPAKEAQEA-------LEVKEDP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711 35/91 (38%)
DCX 308..396 CDD:214711 21/89 (24%)
PKc_like 477..734 CDD:304357
S_TKc 477..734 CDD:214567
Dcdc2cXP_038968640.1 Ubiquitin_like_fold 16..94 CDD:421700 31/82 (38%)
Ubiquitin_like_fold 135..213 CDD:421700 21/81 (26%)
PRK10263 <505..>672 CDD:236669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3757
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.