DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Mapkapk5

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001157515.1 Gene:Mapkapk5 / 498183 RGDID:1564113 Length:473 Species:Rattus norvegicus


Alignment Length:303 Identity:93/303 - (30%)
Similarity:153/303 - (50%) Gaps:52/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 SNIRNTYSLG--RIIGDGNFAIVFKIKHRQTGHSYALKI-IDKNKCKGKEHYIDAEVRV-MKKLN 531
            ::|...||:.  :.:|.|....|.....:.|...:|||| :|:.|.:.       |||: |....
  Rat    14 TSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARN-------EVRLHMMCAT 71

  Fly   532 HPHIISLILSVDQNT-----------NMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAA 585
            |.:|:. |:.|..|:           .:.:|:|.:.||:||..|:|...|:|.|:..:.:.:..|
  Rat    72 HSNIVE-IIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALA 135

  Fly   586 MTYLHSMGIVHRDIKPENLLVKLDEHGNVLE--LKLADFGLA-CEVNDLLYAVCGTPTYVAPEIL 647
            :.:.|.:.|.|||:||||||.|    .|.|:  :||.|||.| .:..||:.... ||.||||::|
  Rat   136 LQHCHLLNIAHRDLKPENLLFK----DNSLDAPVKLCDFGFAKVDQGDLMTPQF-TPYYVAPQVL 195

  Fly   648 ------------------LEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQ---EPLFDAIIS 691
                              ....|....|:|:.|:|:|::|||:|||.:..:.:   :.:...|::
  Rat   196 EAQRRHQKEKSGLIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRKKIMT 260

  Fly   692 GIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSW 734
            |.:|||:..||.|.:..:|::..:|:..|:.|.|.|.:|||.|
  Rat   261 GSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPW 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 91/295 (31%)
S_TKc 477..734 CDD:214567 91/295 (31%)
Mapkapk5NP_001157515.1 STKc_MAPKAPK5 15..304 CDD:271073 93/302 (31%)
S_TKc 26..304 CDD:214567 90/291 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.