DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and camk2d1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_009301756.1 Gene:camk2d1 / 445208 ZFINID:ZDB-GENE-040801-121 Length:591 Species:Danio rerio


Alignment Length:262 Identity:103/262 - (39%)
Similarity:149/262 - (56%) Gaps:8/262 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 YSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHY-IDAEVRVMKKLNHPHIISLIL 540
            |.|...:|.|.|::|.:.....||..||.|||:..|...::|. ::.|.|:.:.|.|.:|:.|..
Zfish    13 YQLYEELGKGAFSVVRRCMKISTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHANIVRLHD 77

  Fly   541 SVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLL 605
            |:.:....|||.:.|:||:||:.|.....:||..:...|:.:..|:.:.|.||:||||:||||||
Zfish    78 SISEEGVHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLL 142

  Fly   606 VKLDEHGNVLELKLADFGLACEV---NDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYI 667
            :.....|  ..:||||||||.||   ....:...|||.|::||:|.:..||..:|:||.|:||||
Zfish   143 LASKLKG--AAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEPYGKPVDMWACGVILYI 205

  Fly   668 LLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDH 732
            ||.|:|||.  |..|..|:..|.:|.|:||.|.|..:....:|||..||..:|..|.|:.:.|.|
Zfish   206 LLVGYPPFW--DEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITAAEALKH 268

  Fly   733 SW 734
            .|
Zfish   269 PW 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 102/260 (39%)
S_TKc 477..734 CDD:214567 102/260 (39%)
camk2d1XP_009301756.1 STKc_CaMKII 11..302 CDD:270988 103/262 (39%)
S_TKc 13..271 CDD:214567 103/262 (39%)
CaMKII_AD 459..586 CDD:285524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.