DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CG31345

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_731744.1 Gene:CG31345 / 41576 FlyBaseID:FBgn0051345 Length:213 Species:Drosophila melanogaster


Alignment Length:124 Identity:28/124 - (22%)
Similarity:53/124 - (42%) Gaps:21/124 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 LVDSEPFKAETTPEDDRHAALLTSTGMEINELPSNIRNTYSLGRIIGDGNFAIV-FKIKHRQTGH 501
            ::|.:..|: .:||:.:..  :|..|:::.:  |.|...:|.....|.||..:. |.:|.|...:
  Fly    54 VMDDDGSKS-LSPEEFKKG--VTDIGLDLTD--SEIDEMFSRFDTDGSGNINMTEFLVKLRPPMN 113

  Fly   502 SYALKII----DKNKCKGKEHYIDAEVRVMKKLN------HPHIISLILSVDQNTNMYL 550
            :..:.||    ||....|     |.::.|....|      ||..:|..::.:|....:|
  Fly   114 NSRISIIEKAFDKMDANG-----DGQITVTDLKNVYSVRDHPKYLSGEMTENQIFTQFL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 20/85 (24%)
S_TKc 477..734 CDD:214567 20/85 (24%)
CG31345NP_731744.1 EF-hand_7 48..105 CDD:290234 12/55 (22%)
EFh 48..105 CDD:238008 12/55 (22%)
EFh 83..136 CDD:238008 14/57 (25%)
EF-hand_7 84..144 CDD:290234 16/64 (25%)
EF-hand_7 120..190 CDD:290234 12/53 (23%)
EFh 120..187 CDD:298682 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.