DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and stk17b

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_956829.1 Gene:stk17b / 393507 ZFINID:ZDB-GENE-040426-1499 Length:354 Species:Danio rerio


Alignment Length:286 Identity:87/286 - (30%)
Similarity:150/286 - (52%) Gaps:16/286 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 AALLTSTGMEINELPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYI 520
            :|||:.....|:..|  :...:.:|:.:|.|.||:|.:...:.||..:|.|.|.|.: :|::...
Zfish    13 SALLSEIHSHIHTDP--LDTLFDIGKELGRGKFAVVKRCVEKTTGKVFAAKFIKKRR-RGRDCRA 74

  Fly   521 DA--EVRVMKKL-NHPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHL 582
            |.  |:.|::.. |:|.:::|....:.:.::.|:||:.:||::|:.........|.|...:||.:
Zfish    75 DVIHEIAVLEAAKNNPRVVNLNAVYETDYDLVLMLEFAAGGEIFNHCVSDELLPEGQITRLIRQM 139

  Fly   583 GAAMTYLHSMGIVHRDIKPEN-LLVKLDEHGNVLELKLADFGLACEVNDL--LYAVCGTPTYVAP 644
            ...:..||...:||.|:||:| ||..|...|   ::|:.|||||..:...  |..:.|||.||||
Zfish   140 LEGIHLLHQSSVVHLDLKPQNILLTSLSPLG---DIKIVDFGLARRLGSAGELREILGTPEYVAP 201

  Fly   645 EILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGI-YEFPDPYWSDIGDGV 708
            |||.........|:|:.|:|.|:|:.|..|| |.|::||...:  :|.: .|:....:|.:.:..
Zfish   202 EILNYEPITTATDLWSVGVITYMLVTGESPF-AGDDKQETFLN--VSQVNVEYSRETFSRVSELA 263

  Fly   709 RDLIANMLQADPDVRFTSEDILDHSW 734
            .|.|..:|...|:.|.::.|.:.|.|
Zfish   264 VDFIRKLLVKAPEDRPSAADCMTHPW 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 81/263 (31%)
S_TKc 477..734 CDD:214567 81/263 (31%)
stk17bNP_956829.1 STKc_DRAK2 24..290 CDD:271100 83/275 (30%)
S_TKc 32..290 CDD:214567 82/265 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.