DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and camkvb

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_956744.1 Gene:camkvb / 393422 ZFINID:ZDB-GENE-040426-1140 Length:436 Species:Danio rerio


Alignment Length:294 Identity:102/294 - (34%)
Similarity:161/294 - (54%) Gaps:19/294 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 PSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPH 534
            |:.|.:.|.||:|:....|..:|:.|.:.|...|..|...|...:........|:.::|.:.||:
Zfish    17 PTEITDKYDLGQIVKSEEFCEIFRAKDKNTLKMYTCKKFLKKDGRKVRKAAKNEIVILKMVKHPN 81

  Fly   535 IISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDI 599
            |:.|:...:.....||.||..:|.::||.|.....:||..:..:||.:..|:.||||:.||||::
Zfish    82 ILQLVDVYETRKEYYLFLELATGREVFDWILDQGYYSERDTSNVIRQVMEAVAYLHSLKIVHRNL 146

  Fly   600 KPENLLV--KLDEHGNVLELKLADFGLACEVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAG 662
            |.|||:.  :| :|..::   ::||.||...|.|:...||||.|:|||::....||..:|.||.|
Zfish   147 KLENLVYYNRL-KHSKIV---ISDFHLAKLENGLIKEPCGTPEYLAPEVVGRQRYGRPVDCWALG 207

  Fly   663 IILYILLCGFPPFV--APD----NQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPD 721
            :|:||||.|.|||.  |.|    |..:.||..|::|.|||..|||.:|.|..::|::.:::.|.|
Zfish   208 VIMYILLSGNPPFYDEADDDDYENHDKNLFRKILAGDYEFDSPYWDEISDSAKNLVSRLMEVDQD 272

  Fly   722 VRFTSEDILDHSWTIGN-------KGNECTTYKR 748
            .|.|:::.::|.|..||       |.|.|...::
Zfish   273 QRLTAQEAINHEWISGNAASDKNIKENVCAQIEK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 94/264 (36%)
S_TKc 477..734 CDD:214567 94/264 (36%)
camkvbNP_956744.1 STKc_CaMK_like 22..286 CDD:270990 94/267 (35%)
S_TKc 24..286 CDD:214567 94/265 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..436
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.