DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and sqa

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster


Alignment Length:258 Identity:90/258 - (34%)
Similarity:140/258 - (54%) Gaps:15/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 IGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHIISLILSVDQNTN 547
            :|.|.|..|:|.:.:..|...|.|.:...|.:.|.: ::.||.:|..|.|..||.|..:.:....
  Fly    40 VGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRN-VEREVEIMNSLQHHLIIQLYAAYEYQKM 103

  Fly   548 MYLVLEYVSGGDLFDAITQVTRF--SENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDE 610
            |.:|||.:.||:|||.:.. ..|  :|...|:.||.:..||.::|..||||.|:||||:|| |.:
  Fly   104 MCVVLELIEGGELFDRVVD-DEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILV-LTQ 166

  Fly   611 HGNVLELKLADFGLA--CEVNDLLYAVCGTPTYVAPEILLE--VGYGLKIDVWAAGIILYILLCG 671
            .||  .:|:.|||||  .:.:..|..:.|||.:||||::..  :.||  .|:|:.|:|.|:|:.|
  Fly   167 KGN--RIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYG--TDMWSVGVICYVLISG 227

  Fly   672 FPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSW 734
            ..||:. :|..|.:.:..|:. |:|.|..::.|.....|.||.:|..|...|.|:.:.:.|.|
  Fly   228 LSPFMG-ENDIETMSNVTIAK-YDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKW 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 89/256 (35%)
S_TKc 477..734 CDD:214567 89/256 (35%)
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 90/258 (35%)
STKc_MLCK 40..289 CDD:271005 90/258 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.