DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and stk17a

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001082806.1 Gene:stk17a / 327345 ZFINID:ZDB-GENE-030131-5556 Length:367 Species:Danio rerio


Alignment Length:290 Identity:86/290 - (29%)
Similarity:152/290 - (52%) Gaps:20/290 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 AALLTSTGMEINELPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKE--H 518
            :.||......|...|...|.....|:.:|.|.||:|.|...:.:|..:|.|.:.|.: ||::  .
Zfish    24 SGLLREIRTAIRSEPFTERYDVIPGKELGRGKFAVVRKCVEKSSGKEFAAKYMRKRR-KGQDCRT 87

  Fly   519 YIDAEVRVMK-KLNHPHIISLILSVDQNTNMYLVLEYVSGGDLFD--AITQVTRFSENQSRIMIR 580
            .|..|:.|:: ....|.:::|....:..:.|.|||||.:||::|:  ...:...|:|.:.:.:::
Zfish    88 EIIHEIAVLELAAACPRVVNLHEVYEMPSEMVLVLEYAAGGEIFNQCVADRDEAFTEQEVKRLMK 152

  Fly   581 HLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGL------ACEVNDLLYAVCGTP 639
            .:...:::||:..:||.|:||:|:|  |.....:.::|:.||||      :.||.:::    |||
Zfish   153 QILEGVSFLHNNNVVHLDLKPQNIL--LTSESPLGDIKIVDFGLSRLLSNSHEVREIM----GTP 211

  Fly   640 TYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDI 704
            .|||||:|.........|:|:.|:::|::|.|..||:..|.|:..|..:.|:..|...:....| 
Zfish   212 EYVAPEVLNYEPISTATDMWSIGVLVYVMLTGISPFLGDDKQETFLNISQINISYSEEELEHLD- 275

  Fly   705 GDGVRDLIANMLQADPDVRFTSEDILDHSW 734
            |..:| .|.::|..:|:.|.|:||.|.|.|
Zfish   276 GSAIR-FIKSLLIKEPENRATAEDCLKHQW 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 80/267 (30%)
S_TKc 477..734 CDD:214567 80/267 (30%)
stk17aNP_001082806.1 PKc_like 35..305 CDD:304357 83/279 (30%)
S_TKc 48..305 CDD:214567 81/266 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.