DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and mapkapk2a

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_958460.1 Gene:mapkapk2a / 327321 ZFINID:ZDB-GENE-030131-5532 Length:382 Species:Danio rerio


Alignment Length:281 Identity:94/281 - (33%)
Similarity:152/281 - (54%) Gaps:34/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 IRNTYSL-GRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHII 536
            |.:.|.: .:::|.|....|.:|.::::|...|||::  :.|......::...|..   :..||:
Zfish    40 ITDDYKITNQVLGLGINGRVLEIFYKRSGEKLALKML--HDCPKARREVELHWRAS---SCTHIV 99

  Fly   537 SLILSVDQNTNMY-------LVLEYVSGGDLFDAITQ--VTRFSENQSRIMIRHLGAAMTYLHSM 592
            .:   ||...|:|       :|:|.:.||:||..|..  ...|:|.::..:::.:|.|:.|||::
Zfish   100 KI---VDVYENLYQNRKCLLIVMECMDGGELFSRIQDRGDQAFTEREASDIMKSIGEAIQYLHAI 161

  Fly   593 GIVHRDIKPENLLVKLDEHGNVLELKLADFGLACE--VNDLLYAVCGTPTYVAPEILLEVGYGLK 655
            .|.|||:||||||. ..:..|.| |||.|||.|.|  .::.|...|.||.|||||:|....|...
Zfish   162 NIAHRDVKPENLLY-TSKRPNAL-LKLTDFGFAKETTTHNSLATPCYTPYYVAPEVLGPEKYDKS 224

  Fly   656 IDVWAAGIILYILLCGFPPF-------VAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIA 713
            .|:|:.|:|:||||||:|||       ::|..::.     |..|.||||:|.||::.:..:.||.
Zfish   225 CDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKKR-----IRMGQYEFPNPEWSEVSEEAKQLIR 284

  Fly   714 NMLQADPDVRFTSEDILDHSW 734
            .:|:.:|..|.|..:.::|.|
Zfish   285 TLLKTEPTQRMTITEFMNHPW 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 92/275 (33%)
S_TKc 477..734 CDD:214567 92/275 (33%)
mapkapk2aNP_958460.1 STKc_MAPKAPK2 42..344 CDD:271072 93/279 (33%)
S_TKc 49..306 CDD:214567 92/272 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.