DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Camk1d

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001100835.1 Gene:Camk1d / 307124 RGDID:1560691 Length:385 Species:Rattus norvegicus


Alignment Length:270 Identity:108/270 - (40%)
Similarity:161/270 - (59%) Gaps:8/270 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 NIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHII 536
            :|:..:.....:|.|.|:.|...:.:.||..:|:|.|.|...||||..|:.|:.|::|:.|.:|:
  Rat    18 DIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIV 82

  Fly   537 SLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKP 601
            :|....:...::|||::.||||:|||.|.:...::|..:..:||.:..|:.|||.|||||||:||
  Rat    83 ALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKP 147

  Fly   602 ENLL-VKLDEHGNVLELKLADFGLAC--EVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGI 663
            |||| ...||...::   ::||||:.  ...|::...||||.|||||:|.:..|...:|.|:.|:
  Rat   148 ENLLYYSQDEESKIM---ISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGV 209

  Fly   664 ILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSED 728
            |.||||||:|||.  |.....||:.|:...|||..|||.||.|..:|.|.|:::.||:.|:|.|.
  Rat   210 IAYILLCGYPPFY--DENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQ 272

  Fly   729 ILDHSWTIGN 738
            ...|.|..|:
  Rat   273 AARHPWIAGD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 105/259 (41%)
S_TKc 477..734 CDD:214567 105/259 (41%)
Camk1dNP_001100835.1 STKc_CaMKI_delta 12..312 CDD:271070 108/270 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.