DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Dcdc2

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001099580.2 Gene:Dcdc2 / 291130 RGDID:1310227 Length:475 Species:Rattus norvegicus


Alignment Length:390 Identity:85/390 - (21%)
Similarity:155/390 - (39%) Gaps:102/390 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 TPTADHIKKRIPSSRTPTRKALRIKFYRNGDRFYPGITIPVSNERYRSFERLFEDLTRLLEENVK 201
            :|.:.|:.:.:..|         :..|||||.|:.|..:.:..::..||:...:::|    ..|:
  Rat     5 SPRSSHLSQPVVKS---------VLVYRNGDPFFAGRRVVIHEKKVSSFDIFLKEVT----GGVQ 56

  Fly   202 IP-GAVRTIYN-LCGKKITSLDELEDGQSYVCSCNNENFKKVEYNTGSQPLSNLPLSNSRSNSHR 264
            .| ||||.||. ..|.:|..||::|.|.:||.. ..|.|||:.|         |.:..       
  Rat    57 APFGAVRNIYTPRTGHRIRKLDQIESGGNYVAG-GQEAFKKLNY---------LDIGE------- 104

  Fly   265 LAKCRPSSPLKNGLLAGSSPFPACGGGTGNGSPLIASRLS----DRVTVVHPRIVTLIRSGTKPR 325
             .|.||...:...:                 .|:|.|:::    .|..:..|..:.||.:|....
  Rat   105 -IKKRPMEAVNTEV-----------------KPVIHSKINVSARFRKALHEPCTIFLIANGDLIS 151

  Fly   326 RIMRLLLNKRNSPSFDHVLTAITQVVRLDTGYVRKVFTLSGIPVVRLSDFFGSDDVFFAYGTERI 390
            ...|||:.::....:||||..:|:.:.|.:|.|.:::||.| .:|.......:...:.|.|.::.
  Rat   152 PASRLLIPRKALNQWDHVLQMVTEKITLRSGAVHRLYTLEG-KLVESGAELENGQFYVAVGRDKF 215

  Fly   391 NTAEDFKLEAEE--------QRAINV--------------IRKTMRTTGTT-CKGPKP------- 425
            ......:|..::        |:|.::              .|::..|.|:: ...|:|       
  Rat   216 KRLPYSELLFDKSAMRRPYGQKASSLPPMVGSRKSKGSGNYRQSKSTIGSSDNSSPQPLKRKGKK 280

  Fly   426 ----------KMPIKSKKVYPPLVDSEP--FKAETTPEDDRHAALL-----TSTGMEINELPSNI 473
                      |..:|||..:..:.|::.  |||.....:.|.||.:     |...:.:::.|:.|
  Rat   281 DSNSEKPTKVKQSVKSKNSHQAIPDNDEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEI 345

  Fly   474  473
              Rat   346  345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711 30/92 (33%)
DCX 308..396 CDD:214711 21/87 (24%)
PKc_like 477..734 CDD:304357
S_TKc 477..734 CDD:214567
Dcdc2NP_001099580.2 Ubiquitin_like_fold 17..96 CDD:421700 29/92 (32%)
DCX2_DCDC2 138..217 CDD:340672 21/79 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..475 21/112 (19%)
2A1904 <250..>445 CDD:273344 19/96 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3757
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.