DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Mapkapk2

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_835203.1 Gene:Mapkapk2 / 289014 RGDID:631362 Length:386 Species:Rattus norvegicus


Alignment Length:332 Identity:108/332 - (32%)
Similarity:170/332 - (51%) Gaps:47/332 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 GPKPKMPIKSKKVYPPLVDSEPFKAETTPEDDRHAALLTSTGMEINELPSNIRNTYSL-GRIIGD 485
            |..|..|..|.   ||...::|    ..|....|    ..:|::|.:  :.|.:.|.: .:::|.
  Rat     7 GQTPPAPFPSP---PPPAPAQP----PPPFPQFH----VKSGLQIRK--NAITDDYKVTSQVLGL 58

  Fly   486 GNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHIISLILSVDQNTNMY- 549
            |....|.:|..::|...:|||::  ..|......::...|..:   .|||:.:   ||...|:| 
  Rat    59 GINGKVLRIFDKRTQQKFALKML--QDCPKARREVELHWRASQ---CPHIVHI---VDVYENLYA 115

  Fly   550 ------LVLEYVSGGDLFDAITQ--VTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLV 606
                  :|:|.:.||:||..|..  ...|:|.::..:::.:|.|:.||||:.|.|||:||||||.
  Rat   116 GRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLY 180

  Fly   607 KLDEHGNVLELKLADFGLACEV--NDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILL 669
             ..:..|.: |||.|||.|.|.  ::.|...|.||.|||||:|....|....|:|:.|:|:||||
  Rat   181 -TSKRPNAI-LKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILL 243

  Fly   670 CGFPPF-------VAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSE 727
            ||:|||       ::|..:..     |..|.||||:|.||::.:.|:.||.|:|:.:|..|.|..
  Rat   244 CGYPPFYSNHGLAISPGMKTR-----IRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTIT 303

  Fly   728 DILDHSW 734
            :.::|.|
  Rat   304 EFMNHPW 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 95/275 (35%)
S_TKc 477..734 CDD:214567 95/275 (35%)
Mapkapk2NP_835203.1 STKc_MAPKAPK2 47..349 CDD:271072 96/279 (34%)
S_TKc 54..311 CDD:214567 95/272 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.