DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Rp1l1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_666358.2 Gene:Rp1l1 / 271209 MGIID:2384303 Length:1859 Species:Mus musculus


Alignment Length:421 Identity:92/421 - (21%)
Similarity:156/421 - (37%) Gaps:116/421 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 NSASG---SACLSNTPTADHIKKRIPS-----SRTPTRKALRIKFYRNGDRFYPGITIPVSNERY 182
            ||..|   .|...:.|...|.:..:||     |.|....|.:|.|.:.||..:.|:.:.|....:
Mouse     2 NSTPGDTRDAPAPSHPAPSHRQCLLPSVAHTPSVTEVTPAKKITFLKRGDPQFAGVRLAVHQRTF 66

  Fly   183 RSFERLFEDLTRLLEENVKIPGAVRTIYNLCG-KKITSLDELEDGQSYVCSCNNENFKKVEYNTG 246
            ::|..|.::|:    :.:.:...||::....| ..:::|::|:||..|:||              
Mouse    67 KTFSSLMDELS----QRMPLSFGVRSVTTPRGLHGLSALEQLQDGGCYLCS-------------- 113

  Fly   247 SQPLSNLPLSNSRSNSHRLAKCRPSSPLKNGLLAGSSP-FPACGGGTGNGSPLIASRLSDRVTVV 310
                ...|...||... ||.:..||        ||.:. |..     |:.:|..:......|.  
Mouse   114 ----DRKPPKTSREPG-RLQRKSPS--------AGQAQVFQG-----GHEAPETSYSWKGPVA-- 158

  Fly   311 HPRIVTLIRSGTKPRRIMRLLLNKRNSPSFDHVLTAITQVVRLDTGYVRKVFTLSGIPVVRLSDF 375
             ||.:||:::| .|||...::|:.:|:.|....|...::::|..   |::|:|..|..|..|...
Mouse   159 -PRRLTLVKNG-DPRRQQTVVLSHKNTRSLAAFLGKASELLRFP---VKQVYTTRGKKVDSLQTL 218

  Fly   376 FGSDDVFFAYGTERINTAEDFKLEAEEQRAINVIRKTMRTTGTT---CKGPKPKMPI-------- 429
            .....|....|.|....     ||.|..|. |..||....|..:   |.||..|..:        
Mouse   219 LDGPSVLVCAGNEAFRC-----LEMENDRG-NRTRKLSSVTARSERGCWGPNAKQSVIHSRGRSG 277

  Fly   430 -KSKKV-----------YP---------PLVDSEPFKAETTPEDDRHAALLTSTGME----INEL 469
             |.::|           :|         |.:|..|......|     .:|:.:..:|    :|| 
Mouse   278 GKLRQVSLTSERSGLSDHPASGHRAWAGPALDRCPQDMPVPP-----GSLVAADDVEKKVCMNE- 336

  Fly   470 PSNIRNTYSLGRIIGDGNFAIVFKIKHRQTG 500
                           ||:.::..|::.:..|
Mouse   337 ---------------DGSLSVEMKVRFQLLG 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711 20/91 (22%)
DCX 308..396 CDD:214711 22/87 (25%)
PKc_like 477..734 CDD:304357 4/24 (17%)
S_TKc 477..734 CDD:214567 4/24 (17%)
Rp1l1NP_666358.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 5/19 (26%)
DCX 42..119 CDD:176357 20/98 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..154 12/52 (23%)
UBQ 156..237 CDD:294102 23/92 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..301 5/37 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..445
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 457..593
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 700..750
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 868..920
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 952..997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1152..1211
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1227..1255
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1298..1350
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1567..1859
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3757
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.