DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Uhmk1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_058989.1 Gene:Uhmk1 / 246332 RGDID:2968 Length:419 Species:Rattus norvegicus


Alignment Length:296 Identity:77/296 - (26%)
Similarity:127/296 - (42%) Gaps:63/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 SLGRI------IGDGNFAIVFKIKHRQTGHS--YALKIIDKNKCKG-----KEHYIDAEVRVMKK 529
            :.||:      :|.|:.|.|::::...|..|  .|||........|     .|:....|...:::
  Rat    18 AFGRLWQVQSRLGSGSSASVYRVRCCGTPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQ 82

  Fly   530 L-NHPHIISL--ILSVDQNTNM---YLVLEYVSGGDLFD-AITQVTRFSENQ--SRIMIRHLG-- 583
            | .|.:|::|  :.::..:.|:   .|:||      |.| :::::..:|.:|  |..||:|..  
  Rat    83 LQGHRNIVTLYGVFTIHFSPNVPSRCLLLE------LLDVSVSELLVYSSHQGCSMWMIQHCARD 141

  Fly   584 --AAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGLACEVNDLLYAVCGTPTYVAPEI 646
              .|:.:||..|.||.|:||.|:|...:...    .||.||||:.:..:.......|..|.|||.
  Rat   142 VLEALAFLHHEGYVHADLKPRNILWSAENEC----FKLIDFGLSFKEGNQDVKYIQTDGYRAPEA 202

  Fly   647 LLE---VGYGLK--------IDVWAAGIILYILLCGFP-PFVAPDNQQEPLFDAIISGIY----- 694
            .|:   ...||:        :|:|:.||||..:..|.. .......:.:....|||..|:     
  Rat   203 ELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAV 267

  Fly   695 ---EFPDPYWSDIGDGVRDLIANMLQADPDVRFTSE 727
               ..|..:       :||||.:||..||..|..:|
  Rat   268 VNAAIPAYH-------LRDLIKSMLHDDPSRRIPAE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 77/296 (26%)
S_TKc 477..734 CDD:214567 77/296 (26%)
Uhmk1NP_058989.1 STKc_KIS 22..308 CDD:270922 75/292 (26%)
RRM_UHMK1 318..405 CDD:409898
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.