DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Rp1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_035413.1 Gene:Rp1 / 19888 MGIID:1341105 Length:2095 Species:Mus musculus


Alignment Length:411 Identity:107/411 - (26%)
Similarity:165/411 - (40%) Gaps:109/411 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LSNTPTAD----HI--KKRIPSSR----TPTRKALRIKFYRNGDRFYPGITIPVSNERYRSFERL 188
            :|:||:..    |:  :.::||.|    |....|.||.||::||..:.|:.:.|:...:::|:.|
Mouse     1 MSDTPSTSFSMIHLTSEGQVPSPRHSNITHPVVAKRISFYKSGDPQFGGVRVVVNPRSFKTFDAL 65

  Fly   189 FEDLTRLLEENVKIPGAVRTIYNLCGK-KITSLDELEDGQSYVCSCNNENFKKVEYNTGSQPLSN 252
            .:.|:|    .|.:|..||.|....|: .||.|:|||||:|||||.|    |||           
Mouse    66 LDSLSR----KVPLPFGVRNISTPRGRHSITRLEELEDGKSYVCSHN----KKV----------- 111

  Fly   253 LPLS------------NSRSNSHRLAKCRPSSPLKNGLLAGSSPFPACGGGTGNGSPLIASRLSD 305
            ||:.            :|||.|..:..|                 ||    |.|.|.:....|. 
Mouse   112 LPVDLDKARRRPRPWLSSRSISTHVQLC-----------------PA----TANMSTMAPGMLR- 154

  Fly   306 RVTVVHPRIVTLIRSGTKPRRIMRLLLNKRNSPSFDHVLTAITQVVRLDTGYVRKVFTLSGIPVV 370
                 .||.:.:.|:| .|:....:||::|.:.||:..|..:|||::..   |.|::...|..|.
Mouse   155 -----APRRLVVFRNG-DPKNKHVVLLSRRITQSFEAFLQYLTQVMQCP---VAKLYATDGRKVP 210

  Fly   371 RLSDFFGSDDVFFAYGTERINTA----EDFKLEAE--------EQRAINVIRKTMRTTGTTCKGP 423
            .|.....|.....|.|.|.....    :.:.|.|:        .|:....|.|...:|..    |
Mouse   211 SLQAVILSSGAVVAAGREPFKPGNYDIQKYLLPAKLPGISHRVHQKGKAKIEKRKMSTHM----P 271

  Fly   424 KPKMP----IKSKKVYPPLVDSEPFKAETTPEDDRHAALLTSTGMEINELPS--NIRNTYSLGRI 482
            ....|    :.|:|.|....|     ....||:  :.||.|.....::..||  ::..:....: 
Mouse   272 SDLRPQTDSLISEKTYDCFSD-----FSVAPEN--YLALETHESQSLSTYPSEDDVEKSIVFNQ- 328

  Fly   483 IGDGNFAIV----FKIKHRQT 499
              ||...:|    ||||..:|
Mouse   329 --DGTMTVVMKVRFKIKEEET 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711 36/91 (40%)
DCX 308..396 CDD:214711 23/91 (25%)
PKc_like 477..734 CDD:304357 8/27 (30%)
S_TKc 477..734 CDD:214567 8/27 (30%)
Rp1NP_035413.1 DCX 35..110 CDD:176357 32/82 (39%)
DCX 157..232 CDD:176357 22/78 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..379
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 643..688
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 863..887
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1400..1430
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1572..1595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3757
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.