DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and rpi-1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001022399.1 Gene:rpi-1 / 189281 WormBaseID:WBGene00012332 Length:450 Species:Caenorhabditis elegans


Alignment Length:442 Identity:91/442 - (20%)
Similarity:151/442 - (34%) Gaps:169/442 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 TSETKTLESVVTTN--SASGSACLSNTPTADHIKKRIPSSRTPTRKALRIKFYRNGDRFYPGITI 175
            |..||.....|..:  |:||.:.||.. ::.:|:|              |..|:||||::.|:..
 Worm     3 TPSTKKKVKKVAEDPLSSSGVSSLSGI-SSYNIRK--------------ISIYKNGDRYHRGVKF 52

  Fly   176 PVSNERYRSFERLFEDLTRLL---EENVKIPGAVRTIYNLCGKKITSLDELEDGQSYVCSCNNEN 237
            .::       .|:.:|:..||   .:.:::....:.:|...||.:.|:.|||||:.||.:  :..
 Worm    53 VIN-------PRVIKDMEPLLNQVNDRIELSHGAKKLYTTDGKIVNSIKELEDGKIYVAA--SAQ 108

  Fly   238 FKKVEY-----------------------------------------NTGSQPLSNLPLSNSRS- 260
            |..:.|                                         |:||...:...:..||| 
 Worm   109 FIPMRYGEFAEKVWKPPSRKHSPIMSSDRIKTARTRSQDPSKRRQPQNSGSSAPTGSGVQRSRSV 173

  Fly   261 -------NSHRLAKCRPSSPLKNGLLAGSSPFPACGGGTGNGSPLIASRLSDRVTVVHP-RIVTL 317
                   .|.|.|  .|:.|..||  |.::| ....|......|.       |.|:..| :|:|.
 Worm   174 RTLAEDRKSRRDA--NPARPNVNG--ASNAP-KKFDGARPKAPPA-------RQTIPKPKKILTT 226

  Fly   318 IRSGTKP----RRIMRLLLN---------------------KRNSPSFDHVLTAITQVVRLDTGY 357
            ..:..||    |::.:.:|.                     ||::|.  .:.||::.        
 Worm   227 STTNKKPPTPKRKVSKKVLGAAAAAGVTVVGAAAIGAVAAAKRSTPK--PIPTAVSD-------- 281

  Fly   358 VRKVFTLSGIPVVRLSDFFGSDDVFFAYGTERINTAEDFKLEAEEQRAINVIRKTMRTTGTTCKG 422
               |.|.|.||:..::                 ..||..:...||::   :...|:..|.|    
 Worm   282 ---VSTASSIPIPNVT-----------------GAAEILEFPEEEKK---IDMATIHRTPT---- 319

  Fly   423 PKPKMPIKSKKVYPPLVDSEP--FKAETTPEDDRHAALLTSTGMEINELPSN 472
                         ||:|.|.|  .||..||. :|.|..|.:..:.....|.:
 Worm   320 -------------PPVVASRPATAKAPGTPA-NRSATALEAKSVSQQPTPES 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711 24/134 (18%)
DCX 308..396 CDD:214711 20/113 (18%)
PKc_like 477..734 CDD:304357
S_TKc 477..734 CDD:214567
rpi-1NP_001022399.1 DCX 32..115 CDD:214711 25/105 (24%)
DUF4045 <123..354 CDD:330572 55/293 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.