DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Camk1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_006237061.1 Gene:Camk1 / 171503 RGDID:629473 Length:414 Species:Rattus norvegicus


Alignment Length:271 Identity:108/271 - (39%)
Similarity:165/271 - (60%) Gaps:10/271 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 NIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHII 536
            :||:.|....::|.|.|:.|...:.::|....|:|.|.|...:|||..::.|:.|:.|:.||:|:
  Rat    46 DIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKEGSMENEIAVLHKIKHPNIV 110

  Fly   537 SLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKP 601
            :|....:...::||:::.||||:|||.|.:...::|..:..:|..:..|:.|||.:||||||:||
  Rat   111 ALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKP 175

  Fly   602 ENLL-VKLDEHGNVLELKLADFGLACEVND---LLYAVCGTPTYVAPEILLEVGYGLKIDVWAAG 662
            |||| ..|||...::   ::||||: ::.|   :|...||||.|||||:|.:..|...:|.|:.|
  Rat   176 ENLLYYSLDEDSKIM---ISDFGLS-KMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIG 236

  Fly   663 IILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSE 727
            :|.||||||:|||.  |.....||:.|:...|||..|||.||.|..:|.|.::::.||:.|||.|
  Rat   237 VIAYILLCGYPPFY--DENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCE 299

  Fly   728 DILDHSWTIGN 738
            ..|.|.|..|:
  Rat   300 QALQHPWIAGD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 104/260 (40%)
S_TKc 477..734 CDD:214567 104/260 (40%)
Camk1XP_006237061.1 STKc_CaMKI_alpha 47..309 CDD:271069 107/267 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.