DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and DCDC2B

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001092904.1 Gene:DCDC2B / 149069 HGNCID:32576 Length:349 Species:Homo sapiens


Alignment Length:381 Identity:89/381 - (23%)
Similarity:147/381 - (38%) Gaps:94/381 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 ALRIKFYRNGDRFYPGITIPVSNERYRSFERLFEDLTRLLEENVKIPGAVRTIYNLC-GKKITSL 220
            |.|:..|||||.|:||..:.|:..|:.:.|....::|    ..|:.|.|||.:|..| |..:|:|
Human     8 AKRVVVYRNGDPFFPGSQLVVTQRRFPTMEAFLCEVT----SAVQAPLAVRALYTPCHGHPVTNL 68

  Fly   221 DELEDGQSYVCSCNNENFKKVEY--NTGSQPLSNLPLSNSRSNSHRLAKCRPSSPLKNGLLAGSS 283
            .:|::...|| :...|.|.|:.|  :.|..|       ..:|       ||...|.....|    
Human    69 ADLKNRGQYV-AAGFERFHKLHYLPHRGKDP-------GGKS-------CRLQGPPVTRHL---- 114

  Fly   284 PFPACGGGTGNGSPLIASRLSDRVTVVHPRIVTLIRSGTKPRRIMRLLLNKRNSPSFDHVLTAIT 348
                |.|..|...|..|           |..:.:.|:|........|.|::..|..::.||..:|
Human   115 ----CDGAIGRQLPAGA-----------PSYIHVFRNGDLVSPPFSLKLSQAASQDWETVLKLLT 164

  Fly   349 QVVRLDTGYVRKVFTLSGIPVVRLSDFFGSDDVFFAYGTERINTAEDFKLEAEEQRAINVIRKTM 413
            :.|:|.:|.|.|:.||.|:|:              :.|.|.:.......:..:|.:.:..:...:
Human   165 EKVKLQSGAVCKLCTLEGLPL--------------SAGKELVTGHYYVAVGEDEFKDLPYLELLV 215

  Fly   414 RTTGTTCKGPKPKMPIKSKKVYPPLVDSEP-------FKAETT------PEDDRHAALLTSTGME 465
                     |.|.:|....:  ||...|.|       .:|:.|      |:..:.:|........
Human   216 ---------PSPSLPRGCWQ--PPGSKSRPHRQGAQGHRAQVTQPSPKEPDRIKPSAFYARPQQT 269

  Fly   466 I---NELPSNIRNTYSL-GRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKE 517
            |   ::||     |.|. ..:||      |:...||:...:.||::.|....:.:|
Human   270 IQPRSKLP-----TLSFPSGVIG------VYGAPHRRKETAGALEVADDEDTQTEE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711 31/89 (35%)
DCX 308..396 CDD:214711 20/87 (23%)
PKc_like 477..734 CDD:304357 10/42 (24%)
S_TKc 477..734 CDD:214567 10/42 (24%)
DCDC2BNP_001092904.1 DCX 9..87 CDD:176357 28/82 (34%)
TGS 131..211 CDD:330245 20/93 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..258 7/37 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3757
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.