DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CAPSL

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_006714507.1 Gene:CAPSL / 133690 HGNCID:28375 Length:225 Species:Homo sapiens


Alignment Length:213 Identity:40/213 - (18%)
Similarity:73/213 - (34%) Gaps:55/213 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EKVKINSLHCNDAVLSSLQASPSATSPQSVPSKANVVTEASIIEKTNQPHNVQEDNNYNRDCDSP 68
            :|:...:.|..:..:.:.:...:||.|........:...::.|:...:...:.:|:| ||..|..
Human    16 QKMAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDN-NRTLDFK 79

  Fly    69 ESSSSEQDKELDDLRNLHSSSLTNSVVVGKSTGSLNGVYSITSVTSETKTLESVVTTNSASGSAC 133
            |..     |.|:|.                            :|..|.:.:|.:.......|:. 
Human    80 EFM-----KGLNDY----------------------------AVVMEKEEVEELFRRFDKDGNG- 110

  Fly   134 LSNTPTADH----IKKRIPSSRTPTRKALRIKFYRNGDRFYPG-ITIPVSNE--------RYRSF 185
                 |.|.    :..|.|.||  .||.:.::.:|..|:...| |||....|        :|::.
Human   111 -----TIDFNEFLLTLRPPMSR--ARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNG 168

  Fly   186 ERLFEDLTRLLEENVKIP 203
            |...|.:.|...:|...|
Human   169 EWSEEQVFRKFLDNFDSP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711 15/60 (25%)
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357
S_TKc 477..734 CDD:214567
CAPSLXP_006714507.1 EF-hand_7 61..118 CDD:290234 15/96 (16%)
EFh 63..118 CDD:238008 15/94 (16%)
EF-hand_7 100..157 CDD:290234 16/64 (25%)
EFh 101..155 CDD:238008 15/61 (25%)
EF-hand_7 133..202 CDD:290234 13/54 (24%)
EFh 133..199 CDD:298682 13/54 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.