DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Dapk2

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_036010488.1 Gene:Dapk2 / 13143 MGIID:1341297 Length:490 Species:Mus musculus


Alignment Length:292 Identity:105/292 - (35%)
Similarity:166/292 - (56%) Gaps:14/292 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 ALLTSTGMEINELPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGK----- 516
            |.:.|..||..: ...:.:.|.:|..:|.|.||||.|.:.:.||..||.|.|.|.:.:..     
Mouse     4 ASMRSPNMETFK-QQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVC 67

  Fly   517 EHYIDAEVRVMKKLNHPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRH 581
            ...|:.||.:::::.||:||:|....:..|::.|:||.||||:|||.:.|....||.::...|:.
Mouse    68 REEIEREVSILRQVLHPNIITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQ 132

  Fly   582 LGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGLACEVND--LLYAVCGTPTYVAP 644
            :...:.|||:..|.|.|:||||::: ||::..:..:||.|||||.|:.|  ....:.|||.:|||
Mouse   133 ILDGVNYLHTKKIAHFDLKPENIML-LDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAP 196

  Fly   645 EILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGI-YEFPDPYWSDIGDGV 708
            ||:.....||:.|:|:.|:|.||||.|..||:. |.:||.|  |.|:.: |:|.:.::|...:..
Mouse   197 EIVNYEPLGLEADMWSIGVITYILLSGASPFLG-DTKQETL--ANITAVSYDFDEEFFSQTSELA 258

  Fly   709 RDLIANMLQADPDVRFTSEDILDHSWTIGNKG 740
            :|.|..:|..:...|.|.::.|.|.| |.:||
Mouse   259 KDFIRKLLVKETRKRLTIQEALRHPW-ITSKG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 97/264 (37%)
S_TKc 477..734 CDD:214567 97/264 (37%)
Dapk2XP_036010488.1 STKc_DAPK2 17..285 CDD:271098 98/272 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.