DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and LOC100496389

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_002937423.1 Gene:LOC100496389 / 100496389 -ID:- Length:385 Species:Xenopus tropicalis


Alignment Length:272 Identity:104/272 - (38%)
Similarity:155/272 - (56%) Gaps:18/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 IRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYID-----AEVRVMKKLNH 532
            :.|.|::|:.:|.|..:.|||.:.:.|...||.|.|.|.        ||     .|:.|:.:|:|
 Frog    21 LENFYTIGQELGRGATSTVFKCEEKGTKKLYAAKKIKKT--------IDLKIVRTEIGVLLRLSH 77

  Fly   533 PHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHR 597
            |:||.|....:.:..:.|:||.|:||:|||.|.:...:||..:..:::.:..|:.|||..|:|||
 Frog    78 PNIIKLKDIFETSAEITLILELVTGGELFDRIVERGYYSEQDAACVVQQILEAVAYLHGNGVVHR 142

  Fly   598 DIKPENLLVKLDEHGNVLELKLADFGLACEVND--LLYAVCGTPTYVAPEILLEVGYGLKIDVWA 660
            |:||||||.......::  ||:|||||:..::|  .:..|||||.|.|||||....||.::|:|:
 Frog   143 DLKPENLLYADMTPDSI--LKIADFGLSKMIDDQVAMKTVCGTPGYCAPEILFGSPYGPEVDMWS 205

  Fly   661 AGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFT 725
            .|||.|||||||.||..|...|. ::..|::..:||..|:|.:|....:||:..::..||..|.|
 Frog   206 VGIITYILLCGFEPFFDPRGDQY-MYSKILNCDFEFVSPWWDEISLNAKDLVKKLIVLDPKKRMT 269

  Fly   726 SEDILDHSWTIG 737
            ....|.|.|..|
 Frog   270 VSQALQHPWVTG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 101/263 (38%)
S_TKc 477..734 CDD:214567 101/263 (38%)
LOC100496389XP_002937423.1 PKc_like 21..314 CDD:389743 104/272 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.