DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and dclk2b

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_021325742.1 Gene:dclk2b / 100332814 ZFINID:ZDB-GENE-110411-1 Length:274 Species:Danio rerio


Alignment Length:250 Identity:88/250 - (35%)
Similarity:138/250 - (55%) Gaps:35/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 SASGSACLSNTPTADH------IKKRIPSSRTPTRKALRIKFYRNGDRFYPGITIPVSNERYRSF 185
            |..||...|..|:..|      .:.|...:.:..::|.:::|||||||::.|:...||::|:||.
Zfish    34 SQQGSRASSLVPSPAHSANCSFYRTRTLQALSSEKRAKKVRFYRNGDRYFKGLVYAVSSDRFRSM 98

  Fly   186 ERLFEDLTRLLEENVKIPGAVRTIYNLCG-KKITSLDELEDGQSYVCSCNNENFKKVEYNTGSQP 249
            :.|..:|||.|.:|:.:|..||.||...| |||:||:||.:|:||||: :||.::||:|.....|
Zfish    99 DALLAELTRALADNLHLPQGVRNIYTADGAKKISSLEELAEGESYVCA-SNEPYRKVDYTKNVNP 162

  Fly   250 LSNLPLSNSRSNSHRLAKCRPSSPLKNGLLAGSSPFPACGGGTGNGSPL---IASRLSDRVTVVH 311
                   |..|.                 :||:....|.|...|...|.   |.....:....:.
Zfish   163 -------NWGSR-----------------MAGAGSVVAAGPVGGAVRPTVQRIVGESRESKDFIK 203

  Fly   312 PRIVTLIRSGTKPRRIMRLLLNKRNSPSFDHVLTAITQVVRLDTGYVRKVFTLSG 366
            |::||:||||.|||:.:|:||||:.:.||:.||..||:.::||:|.|::::||.|
Zfish   204 PKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLADITEAIKLDSGVVKRLYTLDG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711 42/91 (46%)
DCX 308..396 CDD:214711 27/58 (47%)
PKc_like 477..734 CDD:304357
S_TKc 477..734 CDD:214567
dclk2bXP_021325742.1 DCX 66..156 CDD:214711 42/90 (47%)
TGS 200..>262 CDD:330245 27/58 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9573
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D291886at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.