DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and si:ch73-60h1.1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_002663771.2 Gene:si:ch73-60h1.1 / 100332381 ZFINID:ZDB-GENE-140106-152 Length:438 Species:Danio rerio


Alignment Length:272 Identity:101/272 - (37%)
Similarity:163/272 - (59%) Gaps:14/272 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 SNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHI 535
            :.:.:.|::|..:|.|..::|.:.:.:||...||:|::.|...|   ..:..|:.|:.:|:||:|
Zfish    22 ATVEDFYNMGPELGRGATSVVLRCEEKQTEKPYAVKVLKKTIDK---KIVRTEIGVLLRLSHPNI 83

  Fly   536 ISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIK 600
            |.|....:..|.::|:||.|:||:|||.|.:...:||..:..:|:.:..|:.|||..|:||||:|
Zfish    84 IRLKEIFETETEIFLILELVTGGELFDRIVERGYYSERDAAHVIKQILEAVAYLHENGVVHRDLK 148

  Fly   601 PENLL---VKLDEHGNVLELKLADFGLACEVND--LLYAVCGTPTYVAPEILLEVGYGLKIDVWA 660
            |||||   :.:|     ..||:|||||:..:::  .:..|||||.|.|||||....||.::|:|:
Zfish   149 PENLLYADLSID-----APLKIADFGLSKIIDEQVTMKTVCGTPGYCAPEILRGNAYGPEVDMWS 208

  Fly   661 AGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFT 725
            .|:|||||||||.||......|. ::..|::..|||..|:|.::....:||:..::..||..|.|
Zfish   209 VGVILYILLCGFEPFFDQRGDQY-MYSRILNCDYEFVSPWWDEVSLNAKDLVNKLIVLDPHKRLT 272

  Fly   726 SEDILDHSWTIG 737
            .:..|:|.|.:|
Zfish   273 VKQALEHPWVLG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 99/261 (38%)
S_TKc 477..734 CDD:214567 99/261 (38%)
si:ch73-60h1.1XP_002663771.2 STKc_CaMKIV 24..317 CDD:270987 101/270 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.