DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and dclk1b

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001120946.1 Gene:dclk1b / 100151759 ZFINID:ZDB-GENE-080516-7 Length:194 Species:Danio rerio


Alignment Length:88 Identity:42/88 - (47%)
Similarity:65/88 - (73%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 ELPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNH 532
            ::|::|...|.:||:|||||||:|.:...|.:|..||||||:|:||:||||.|..||.:::|:.|
Zfish    88 QVPASIAERYKVGRMIGDGNFAVVRECVERSSGREYALKIINKSKCRGKEHMIQNEVSILRKVKH 152

  Fly   533 PHIISLILSVDQNTNMYLVLEYV 555
            |:|:.||..:|..:.:|:|:|.|
Zfish   153 PNIVLLIEEMDTYSELYMVMELV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 40/79 (51%)
S_TKc 477..734 CDD:214567 40/79 (51%)
dclk1bNP_001120946.1 PKc_like 90..>176 CDD:304357 42/86 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 312 1.000 Domainoid score I1275
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 466 1.000 Inparanoid score I1506
OMA 1 1.010 - - QHG45305
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002635
OrthoInspector 1 1.000 - - otm26127
orthoMCL 1 0.900 - - OOG6_103814
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4535
SonicParanoid 1 1.000 - - X2002
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.