DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and dclk1b

DIOPT Version :10

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001120946.1 Gene:dclk1b / 100151759 ZFINID:ZDB-GENE-080516-7 Length:194 Species:Danio rerio


Alignment Length:88 Identity:42/88 - (47%)
Similarity:65/88 - (73%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 ELPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNH 532
            ::|::|...|.:||:|||||||:|.:...|.:|..||||||:|:||:||||.|..||.:::|:.|
Zfish    88 QVPASIAERYKVGRMIGDGNFAVVRECVERSSGREYALKIINKSKCRGKEHMIQNEVSILRKVKH 152

  Fly   533 PHIISLILSVDQNTNMYLVLEYV 555
            |:|:.||..:|..:.:|:|:|.|
Zfish   153 PNIVLLIEEMDTYSELYMVMELV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX1 156..239 CDD:340526
Ubl1_cv_Nsp3_N-like 309..392 CDD:475130
Protein Kinases, catalytic domain 477..734 CDD:473864 40/79 (51%)
dclk1bNP_001120946.1 Protein Kinases, catalytic domain 90..>176 CDD:473864 42/86 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.