DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and camk1da

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001116532.1 Gene:camk1da / 100144566 ZFINID:ZDB-GENE-080402-7 Length:433 Species:Danio rerio


Alignment Length:269 Identity:109/269 - (40%)
Similarity:164/269 - (60%) Gaps:6/269 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 NIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHII 536
            ||:..:....::|.|.|:.|...:.|.||..||:|.|.|...||||..|:.|:.|::|:.|.:|:
Zfish    20 NIKEIFEFKEVLGTGAFSEVVLAEERSTGKMYAVKCIPKKALKGKESSIENEIAVLRKIKHENIV 84

  Fly   537 SLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKP 601
            :|....:.:.::||:::.||||:|||.|.:...::|..:..:||.:..|:.|||:|||||||:||
Zfish    85 ALEDIYESSDHLYLIMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVNYLHTMGIVHRDLKP 149

  Fly   602 ENLLVKLDEHGNVLELKLADFGLAC--EVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGII 664
            ||||....:.|:  ::.::||||:.  ...|::...||||.|||||:|.:..|...:|.|:.|:|
Zfish   150 ENLLYFNPQDGS--KIMISDFGLSKMEGTGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVI 212

  Fly   665 LYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDI 729
            .||||||:|||.  |.....||:.|:...|||..|||.||.|..:|.|:.:::.||..|.|.|..
Zfish   213 AYILLCGYPPFY--DENDSKLFEQILKADYEFDAPYWDDISDSAKDFISCLMEKDPSKRNTCEQA 275

  Fly   730 LDHSWTIGN 738
            |.|.|..|:
Zfish   276 LRHPWIAGD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 105/258 (41%)
S_TKc 477..734 CDD:214567 105/258 (41%)
camk1daNP_001116532.1 STKc_CaMKI_delta 14..314 CDD:271070 109/269 (41%)
S_TKc 25..281 CDD:214567 105/259 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.