DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and pnck

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001096459.1 Gene:pnck / 100125076 XenbaseID:XB-GENE-961042 Length:339 Species:Xenopus tropicalis


Alignment Length:281 Identity:110/281 - (39%)
Similarity:166/281 - (59%) Gaps:5/281 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 GMEINELPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVM 527
            |..:.:...:|...|::...:|.|.|:.|...:.:.:....|||.|.|...:|||..::.|:.|:
 Frog     4 GKNVKKKIEDINMAYNIKEKLGAGAFSEVVLAQEKNSERLVALKCIPKKALRGKEAVVENEIAVL 68

  Fly   528 KKLNHPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSM 592
            ||:.|.:|:||....:..|::||.:|.|:||:|||.|.:...::|..:..:||.:..|:.|||:|
 Frog    69 KKITHKNIVSLEDIYESPTHLYLAMELVTGGELFDRIIERGYYTEKDASQLIRQVLDAVQYLHNM 133

  Fly   593 GIVHRDIKPENLLVKLDEHGNVLELKLADFGLA-CEVNDLLYAVCGTPTYVAPEILLEVGYGLKI 656
            ||||||:||||||.......:  ::.::||||: .|...::...||||.|||||:|.:..||..:
 Frog   134 GIVHRDLKPENLLYATPFEDS--KIMISDFGLSKIEDGGMMATACGTPGYVAPELLEQKPYGKAV 196

  Fly   657 DVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPD 721
            ||||.|:|.||||||:|||.  |.....||:.|:...|||..|||.||.:..:|.|.::|:.:|:
 Frog   197 DVWAIGVISYILLCGYPPFY--DENDSELFNQILKAEYEFDSPYWDDISESAKDFIRHLLEREPE 259

  Fly   722 VRFTSEDILDHSWTIGNKGNE 742
            .|.|.|..|.|.|..|:...|
 Frog   260 KRLTCEQALQHPWICGDTALE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 105/257 (41%)
S_TKc 477..734 CDD:214567 105/257 (41%)
pnckNP_001096459.1 STKc_CaMKI_beta 14..290 CDD:271071 109/271 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.