DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and ARHGAP25

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_016860912.1 Gene:ARHGAP25 / 9938 HGNCID:28951 Length:650 Species:Homo sapiens


Alignment Length:359 Identity:84/359 - (23%)
Similarity:149/359 - (41%) Gaps:60/359 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 LDSCEVLDTCDIPSTL--FTDVVLISETDMKRLQTILWLELATIFDRNKVSLDKRKPFKRRRKEE 353
            |..|.:.:....|...  |...::.:..|..|:....::.:|:    ::..:::...|.||....
Human    96 LPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMAS----SQAEMEEWVKFLRRVAGT 156

  Fly   354 --GNLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNE 416
              |.:||..::..:..:|:.   ...|||:.:||....:|..|..|||:.|:.|.    :.|..:
Human   157 PCGAVFGQRLDETVAYEQKF---GPHLVPILVEKCAEFILEHGRNEEGIFRLPGQ----DNLVKQ 214

  Fly   417 LESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSIDQ------ 475
            |...|  :.....:..|...||.::||||.:||:||:|::.....:.|..|..|.:.|:      
Human   215 LRDAF--DAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQE 277

  Fly   476 -MNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNS 539
             |..|||    ||.:|.:.|..:..|.:.|.....:|||:|.|:||::..::...:...|     
Human   278 LMKQLSI----LPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDP----- 333

  Fly   540 IAEQVRMAAQCCRLTNILILRGEKLF----QVPNNLIVESQKTMMGKK-------GWHRHRN--- 590
             |..:|...|..|:..::|...|.||    .:|  |...:||....|.       ||....:   
Human   334 -AVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIP--LSPPAQKNDPKKAPVARSSVGWDATEDLRI 395

  Fly   591 ----------SNEITAKPSGKASNVGVGHDSTVI 614
                      |:..|..|:|:..:.....||:.:
Human   396 SRTDSFSSMTSDSDTTSPTGQQPSDAFPEDSSKV 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 62/230 (27%)
ARHGAP25XP_016860912.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.