DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and SRGAP3

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_016863063.1 Gene:SRGAP3 / 9901 HGNCID:19744 Length:1117 Species:Homo sapiens


Alignment Length:688 Identity:126/688 - (18%)
Similarity:231/688 - (33%) Gaps:228/688 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KPFEQGLEVSKK------DLEPILTTLSKPHAEAI----------VQLVRTLNKT-----VRVRT 100
            |..|.||::.::      :|..::.|....|||:|          .|..:..||:     ..:|.
Human   159 KSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGDLSMNLLRH 223

  Fly   101 KSRPKRKPDIRDVFREFDEQGTVTRSRSATPDSLDSLQIDEAWTNNSLPTFVNVYEKNTETAIQC 165
            :.||:|:..::.:.:       :...|.|                           |.:|..::|
Human   224 EDRPQRRSSVKKIEK-------MKEKRQA---------------------------KYSENKLKC 254

  Fly   166 VEQSNEIYLKQNLRRTPSAPPKSGTY--ADI-------FRGSQVRCDIPLYSAD-GVELLGYSRI 220
            .:..|:..|  ||..|.:|..|...:  :|:       |..|..|......||: .:|...:..:
Human   255 TKARNDYLL--NLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGL 317

  Fly   221 GTIQFPRNRSVSDPFCSIGRSKESRSEN-DARSQKKKSSEVLSASENECGRLLPMPYNVLSFE-- 282
            ..|                   |:..:| |:||.|....::       |.::...|   |.||  
Human   318 DVI-------------------ENAVDNLDSRSDKHTVMDM-------CNQVFCPP---LKFEFQ 353

  Fly   283 -----SICRDSS----------------------SLDSCEVLDTCDIPSTLFTDVVLI------- 313
                 .:|:.|:                      .:::.||..|.|.......|::.:       
Human   354 PHMGDEVCQVSAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSD 418

  Fly   314 ---------------SETDMKRLQ-------------------------TILWLELATIFDRNKV 338
                           |||.|.::.                         :.|..:|....|..|.
Human   419 AFQHSRSTESVKSAASETYMSKINIAKRRANQQETEMFYFTKFKEYVNGSNLITKLQAKHDLLKQ 483

  Fly   339 SLDK---------------RKPFKRRRKE-----EGNLFGVSINALIRRDQQVTGTDSSLVPLFL 383
            :|.:               .||.|.||..     ...||..|:.|.|:...|.       :||.:
Human   484 TLGEGERAECGTTRPPCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIKDSGQA-------IPLVV 541

  Fly   384 EKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWL 448
            |..|..:...|.:::|:.|:.|    :::..|:::::|.:..|.|.:......::.::.:||.:.
Human   542 ESCIRYINLYGLQQQGIFRVPG----SQVEVNDIKNSFERGEDPLVDDQNERDINSVAGVLKLYF 602

  Fly   449 RELPQPLLTNELIQLFYQCHTLPS-IDQMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINK 512
            |.|..||...|..|.......|.: .::::.:..:...||......:|.|.:|.|.:....|.|.
Human   603 RGLENPLFPKERFQDLISTIKLENPAERVHQIQQILVTLPRVVIVVMRYLFAFLNHLSQYSDENM 667

  Fly   513 MNVHNVATIMAPSMFPPRYIHPSDNNSIAEQVRMAAQCCRLTNILILRGEKLFQVPNNLIVES-- 575
            |:.:|:|....|::     :|..|..   :.|...|....:...:|:..|.:|..|..|  |.  
Human   668 MDPYNLAICFGPTL-----MHIPDGQ---DPVSCQAHINEVIKTIIIHHEAIFPSPREL--EGPV 722

  Fly   576 -QKTMMGKKGWHRHRNSNEITAKPSGKASNVG-VGHDS 611
             :|.|.|         ..|....|..:...:. |.||:
Human   723 YEKCMAG---------GEEYCDSPHSEPGAIDEVDHDN 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 49/223 (22%)
SRGAP3XP_016863063.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.