DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and STARD8

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_005262371.1 Gene:STARD8 / 9754 HGNCID:19161 Length:1107 Species:Homo sapiens


Alignment Length:615 Identity:132/615 - (21%)
Similarity:245/615 - (39%) Gaps:148/615 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EDGEMEAEW--------------LVSAG--------YPEL--TKPFEQGLEVSKKDLEPILTTLS 78
            |||...|:|              ..|.|        .|||  .:|...|.|...:|.|.  :..|
Human   326 EDGHRLADWQPGRRWGCEGRRGSCGSTGSHASTYDNLPELYPAEPVMVGAEAEDEDDEE--SGGS 388

  Fly    79 KPHAEAIVQLVRTLNKTVRVRTKSRPKRKPDIRDVFREFDEQGT-----VTRSRSATPDSLDSLQ 138
            ..|.:.|:|.|..|.:.|.:.:::   ..||:.....| :|:.|     .|.......::|..::
Human   389 YAHLDDILQHVWGLQQRVELWSRA---MYPDLGPGDEE-EEEATSSVEIATVEVKCQAEALSQME 449

  Fly   139 I-----DEAWTNNSLPTFVNVYEKNTETAIQCVEQSNEIYLKQNLRRTPSAPPKSGTYADIFRGS 198
            :     ..||....:...|....:....|....::..|....     .|:..|...:..:...|.
Human   450 VPAHGESPAWAQAEVQPAVLAPAQAPAEAEPVAQEEAEAPAP-----APAPAPAQDSEQEAHSGG 509

  Fly   199 QVRCDIPLYSADGVELLGYSRIGTIQFPRNRSVSDPFCSIGRSKESRSENDARSQKKKSSEV--L 261
            :     |.:::            ::......|:||   ::..|.|..|..::.::.:.:..:  |
Human   510 E-----PTFAS------------SLSVEEGHSISD---TVASSSELDSSGNSMNEAEAAGPLAGL 554

  Fly   262 SAS------ENECGRLLPMPYNVL---SFESICRDSSSLDSCEVLDTCDIPSTLFT-DVVLISET 316
            .||      ::..|..|..|...|   ||::..|.|.:.:|.|:       :..|. .:.|:.:.
Human   555 QASMPRERRDSGVGASLTRPCRKLRWHSFQNSHRPSLNSESLEI-------NRQFAGQINLLHKG 612

  Fly   317 DMKRLQTILWLELATIFDRN--KVSLDKRKPFKRRRKEEG----NLFGVSINALIRRDQQVTGTD 375
            .:.||..  ::|..|:..:.  ..|:.|   |.||.|...    ::|||.....::|..|.    
Human   613 SLLRLTA--FMEKYTVPHKQGWVWSMPK---FMRRNKTPDYRGQHVFGVPPLIHVQRTGQP---- 668

  Fly   376 SSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTFYQNPDNLDNLFRTATVHEL 440
               :|..:::.:..|..:...:.|:.|..|.|.:.:.| .::..|   :|||:  .:...:.:::
Human   669 ---LPQSIQQAMRYLRSQCLDQVGIFRKSGVKSRIQNL-RQMNET---SPDNV--CYEGQSAYDV 724

  Fly   441 SSLLKRWLRELPQPLLTNELIQLFYQCHTLPSIDQ-MNALSILCHLLPPENRNTLRSLLSFFNII 504
            :.|||::.|:||:|:.|::|...|.|.:.|...|| :.|......|||.|||..|::||.|.:.|
Human   725 ADLLKQYFRDLPEPIFTSKLTTTFLQIYQLLPKDQWLAAAQAATLLLPDENREVLQTLLYFLSDI 789

  Fly   505 INLKDINKMNVHNVATIMAPSMF------------------------PPRYIHPSDNNSIAEQV- 544
            .:.:: |:|...|:|..:|||:|                        .||.:  |||.:..:.: 
Human   790 ASAEE-NQMTAGNLAVCLAPSIFHLNVSKKDSPSPRIKSKRSLIGRPGPRDL--SDNMAATQGLS 851

  Fly   545 RMAAQCCRLTNILILRGEKLFQVPNNLIVE 574
            .|.:.|           :||||||.:::::
Human   852 HMISDC-----------KKLFQVPQDMVLQ 870

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 63/245 (26%)
STARD8XP_005262371.1 SAM_superfamily 31..90 CDD:301707
RhoGAP 653..867 CDD:295372 63/240 (26%)
START_STARD8-like 894..1098 CDD:176916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.