DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and ARHGAP12

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_060757.4 Gene:ARHGAP12 / 94134 HGNCID:16348 Length:846 Species:Homo sapiens


Alignment Length:601 Identity:124/601 - (20%)
Similarity:232/601 - (38%) Gaps:128/601 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNTDLHHSDDQDFSEFLNEYYLQSNSQS-----IEPEASYEDGEMEAEWLVSAGYPE---LTKPF 59
            |..|..:..||:.......||..|.|||     ..|....|:.:.....|.::.|..   |....
Human   305 SKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYTNEKWLKHVD 369

  Fly    60 EQGLEV------SKKDLEPILTTLSKPHAEAIVQLVRTLNKTVRVRTKSRPKRKPDIRDVFR--- 115
            :||.:.      |:.:.|     |.|.:|.:..|     .:.::.|:..|..::|.:...:|   
Human   370 DQGRQYYYSADGSRSEWE-----LPKYNASSQQQ-----REIIKSRSLDRRLQEPIVLTKWRHST 424

  Fly   116 ---EFDEQGTVTRSRSATPDSLDSLQIDEAWTNNSLPTFVNVYEKNTETAIQCVEQSNEIYLKQN 177
               :.:::.:.|.|:...|:            |.|.|:    ..|:.:||....:|  |.|...|
Human   425 IVLDTNDKESPTASKPCFPE------------NESSPS----SPKHQDTASSPKDQ--EKYGLLN 471

  Fly   178 LRRTPSAPPKSGTYADIFRGSQVRCDIPLYSADGVELLGYSRI-------GTIQFPRNRSVSDPF 235
            :.:...            .|.:||.:   :.:....|.|.|.:       .|..|..|:|..:..
Human   472 VTKIAE------------NGKKVRKN---WLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFT 521

  Fly   236 CSIGRSKESRSENDARSQK-------KKSSEVLSASENECGRLLPMPYNVLSFESICRDSSSLDS 293
            ..:..:....:..|..|:|       ::.:|:|..|:|:  .::...:.||| .:|...:...|.
Human   522 VDLKGATIEMASKDKSSKKNVFELKTRQGTELLIQSDND--TVINDWFKVLS-STINNQAVETDE 583

  Fly   294 CEVLDTCDIPSTLFTDVVLISETDMKRLQTILWLELATIFD----RNKVSLDK---RKPFKRRRK 351
            ....:..|.|.....|    .|.:.|..:.:...::::|..    :.|.:|.|   |:|..:..:
Human   584 GIEEEIPDSPGIEKHD----KEKEQKDPKKLRSFKVSSIDSSEQKKTKKNLKKFLTRRPTLQAVR 644

  Fly   352 EEG----NLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHK---QK 409
            |:|    .:||.::..|.:|:   .||    ||.|::..|..:...|...:|:.|:.|:.   ||
Human   645 EKGYIKDQVFGSNLANLCQRE---NGT----VPKFVKLCIEHVEEHGLDIDGIYRVSGNLAVIQK 702

  Fly   410 TELLYNELESTFYQNPDNLD-NLFRTATVHELSSLLKRWLRELPQPLLT----NELIQLFYQCHT 469
            .....|        :.:.|| |..:...:|.::..||.:.||||:||.|    |:.:....|   
Human   703 LRFAVN--------HDEKLDLNDSKWEDIHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQ--- 756

  Fly   470 LPSIDQMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPR---- 530
             ....::.|:..|...||..|::|::.|......:|...:.|:|...::|.:..|::..|.    
Human   757 -EPRQRVAAVKDLIRQLPKPNQDTMQILFRHLRRVIENGEKNRMTYQSIAIVFGPTLLKPEKETG 820

  Fly   531 --YIHPSDNNSIAEQV 544
              .:|....|.|.|.:
Human   821 NIAVHTVYQNQIVELI 836

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 49/203 (24%)
ARHGAP12NP_060757.4 SH3-WW_linker 71..266 CDD:293224
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..241
WW 268..298 CDD:238122
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..316 3/10 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..466 10/55 (18%)
PH_ARHGAP9-like 465..576 CDD:270053 24/128 (19%)
PH 479..574 CDD:278594 20/100 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 580..629 8/52 (15%)
RhoGAP_ARHGAP27_15_12_9 654..839 CDD:239868 49/202 (24%)
SH3_ARHGAP12 15..74 CDD:213003
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.